DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42237 and LOC101885160

DIOPT Version :9

Sequence 1:NP_572855.1 Gene:CG42237 / 32261 FlyBaseID:FBgn0250862 Length:363 Species:Drosophila melanogaster
Sequence 2:XP_005169114.1 Gene:LOC101885160 / 101885160 -ID:- Length:463 Species:Danio rerio


Alignment Length:231 Identity:58/231 - (25%)
Similarity:101/231 - (43%) Gaps:46/231 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 SNDSLIMIYYHDLT---------IA--VTELGPQKLLLGCELIEIYNDKEGKMLLEGLSHYNRPL 182
            |.|:.::.|:...|         |:  |:::  |:.|..|....|..|.:||     .|.||...
Zfish    53 SQDASLLFYWSKWTPDQRVKECFISRDVSQI--QRYLSFCHEERIIWDSDGK-----FSRYNLTA 110

  Fly   183 EIKFDEMLKLMDQCEHVDKLSYASRHKSKLEGGERSNGGSASATTGGANDGVALKLATNIFPRSP 247
            .::.|.:.::        .|:..|....:.|..:::.                 ::.:.:..||.
Zfish   111 LLEDDGLCQI--------NLNINSSLTLREENAKQNQ-----------------QMDSRVKIRSK 150

  Fly   248 FSLLSGIIPGTKWCGTGDIAETYSDLGSEMAMDRCCRQHDLCPIKIRAYQNKYELMNDSLYTKSH 312
               .:.::|||.|||.|..|..|..||.....|||||:||.|...||::...:.:.|.:.:|.||
Zfish   151 ---RAWVLPGTLWCGRGTNANDYEQLGMFEHADRCCREHDHCEHIIRSFSVNFGVFNPTFFTVSH 212

  Fly   313 CICDDMLFSCLKMTNTSASQLMGSIYFNLVQVPCLD 348
            |.||.....||...|.:.|.::|..:||::::.|.:
Zfish   213 CDCDHRFKQCLLGGNDTISNMVGYSFFNVLKIRCFE 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42237NP_572855.1 PLA2_bee_venom_like 254..348 CDD:153093 36/93 (39%)
LOC101885160XP_005169114.1 Phospholip_A2_2 155..249 CDD:283483 36/94 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579347
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm25517
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.