DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42237 and oc90

DIOPT Version :9

Sequence 1:NP_572855.1 Gene:CG42237 / 32261 FlyBaseID:FBgn0250862 Length:363 Species:Drosophila melanogaster
Sequence 2:XP_031760051.1 Gene:oc90 / 100491062 XenbaseID:XB-GENE-6461030 Length:557 Species:Xenopus tropicalis


Alignment Length:99 Identity:25/99 - (25%)
Similarity:40/99 - (40%) Gaps:22/99 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 WCGTGDIAETYSDLGSEM----------AMDRCCRQHDLC--PIKIRAYQNKYELMNDSLYT--K 310
            :|.||...|.:...|...          |:|.||..|..|  .:|....|.:..:.::.|..  |
 Frog   388 FCLTGRCPEEFESYGCYCGQDGKGNPIDALDSCCFSHHCCIEHLKKLGCQPQRNIRSEVLCLDHK 452

  Fly   311 SHC----ICDDMLFSCLKMTNTSASQLMGSIYFN 340
            ..|    |||.:|.:|.|    :|::.|.:..:|
 Frog   453 PTCLGWGICDKLLCACDK----AAAECMAAAPYN 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42237NP_572855.1 PLA2_bee_venom_like 254..348 CDD:153093 25/99 (25%)
oc90XP_031760051.1 otoconin_90 81..198 CDD:153096
PLA2_like 383..497 CDD:414410 25/99 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1422829at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.