DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42237 and proca1

DIOPT Version :9

Sequence 1:NP_572855.1 Gene:CG42237 / 32261 FlyBaseID:FBgn0250862 Length:363 Species:Drosophila melanogaster
Sequence 2:XP_009289846.1 Gene:proca1 / 100149324 ZFINID:ZDB-GENE-110418-1 Length:729 Species:Danio rerio


Alignment Length:254 Identity:68/254 - (26%)
Similarity:117/254 - (46%) Gaps:24/254 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 QGFPSFQSFTQQIIEQRSARQMKTYSGKRVSNDSLIMIYYHDLTIAVTELGPQKLLLGCELIEIY 163
            :.|...:..:|.:..::.::::.......:...|.::..||  ...||:        |.|.:...
Zfish    14 RNFVKGEFLSQTLDAEKESKELFYMLNNTLCAKSSVVGEYH--LHQVTD--------GAEEVRSV 68

  Fly   164 NDKEGKMLLEGLSHYNRPLEIKFDEMLKLMDQCEHVDKLSYASRHKSKLEGGERSNGGSASATTG 228
            :|.||::|  ..|.....:::|     ..|..|....:...:|..|..|.|...:........:.
Zfish    69 HDSEGRLL--DCSVIQNQMQVK-----SFMHVCRLGLRNQMSSDLKMSLTGVSEAKANCNKLRSK 126

  Fly   229 GANDGV----ALKLATNIFPRSPFSLLSGIIPGTKWCGTGDIAETYSDLGSEMAMDRCCRQHDLC 289
            ||.:.:    .:|.|:|...|:....   ..|||.|||.|:||:.|..||.....|||||.||.|
Zfish   127 GAKNVIPTTKQVKEASNKKTRTKRGF---TYPGTLWCGAGNIADHYEQLGEFEETDRCCRVHDHC 188

  Fly   290 PIKIRAYQNKYELMNDSLYTKSHCICDDMLFSCLKMTNTSASQLMGSIYFNLVQVPCLD 348
            |..|.|:.:.|...|...::.|||.||:.|..||::.|.::|:::|..:||:::|||.:
Zfish   189 PYVIHAFSSNYGYTNFKWHSLSHCDCDNALKECLRLVNDTSSRVVGQAFFNVIEVPCFE 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42237NP_572855.1 PLA2_bee_venom_like 254..348 CDD:153093 41/93 (44%)
proca1XP_009289846.1 PLA2_bee_venom_like 152..248 CDD:153093 41/99 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I6860
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm25517
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.