DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer3HCH and FTMT

DIOPT Version :9

Sequence 1:NP_572854.1 Gene:Fer3HCH / 32260 FlyBaseID:FBgn0030449 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_803431.1 Gene:FTMT / 94033 HGNCID:17345 Length:242 Species:Homo sapiens


Alignment Length:166 Identity:75/166 - (45%)
Similarity:103/166 - (62%) Gaps:4/166 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VRQNFAKSCEKKLNDQINMELKASHQYLAMAYHFDRSDISSPGMHRFFLKASVEEREHAEKIMTY 80
            |||||....|..:|.|||:||.||:.||:|||:|.|.|::.....|:||..|.||.|||||:|..
Human    68 VRQNFHPDSEAAINRQINLELYASYVYLSMAYYFSRDDVALNNFSRYFLHQSREETEHAEKLMRL 132

  Fly    81 MNKRGGLIILSSVPQP-LPCFASTLDALKHAMKMELEVNKHLLDLHALAGKEADPNLCDFIEANF 144
            .|:|||.|.|..:.:| ...:.|.|.|::.|:.:|..||:.||:|||||..:.||:||||:|..:
Human   133 QNQRGGRIRLQDIKKPEQDDWESGLHAMECALLLEKNVNQSLLELHALASDKGDPHLCDFLETYY 197

  Fly   145 LQEQVDGQKILADYISQLEK---AQNQVGEFLFDKY 177
            |.|||...|.|.|::..|.|   ....:.|:|||.:
Human   198 LNEQVKSIKELGDHVHNLVKMGAPDAGLAEYLFDTH 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer3HCHNP_572854.1 Euk_Ferritin 24..177 CDD:153114 70/156 (45%)
Ferritin 25..165 CDD:278632 66/143 (46%)
FTMTNP_803431.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 47..71 2/2 (100%)
Euk_Ferritin 73..233 CDD:153114 70/159 (44%)
Ferritin 77..218 CDD:278632 65/140 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142877
Domainoid 1 1.000 128 1.000 Domainoid score I5305
eggNOG 1 0.900 - - E1_COG1528
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H110661
Inparanoid 1 1.050 144 1.000 Inparanoid score I4447
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249457at2759
OrthoFinder 1 1.000 - - FOG0000169
OrthoInspector 1 1.000 - - otm41906
orthoMCL 1 0.900 - - OOG6_100688
Panther 1 1.100 - - O PTHR11431
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4342
SonicParanoid 1 1.000 - - X152
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1413.830

Return to query results.
Submit another query.