DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer3HCH and Fthl17e

DIOPT Version :9

Sequence 1:NP_572854.1 Gene:Fer3HCH / 32260 FlyBaseID:FBgn0030449 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_112551.2 Gene:Fthl17e / 83457 MGIID:1933180 Length:176 Species:Mus musculus


Alignment Length:165 Identity:59/165 - (35%)
Similarity:97/165 - (58%) Gaps:4/165 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VRQNFAKSCEKKLNDQINMELKASHQYLAMAYHFDRSDISSPGMHRFFLKASVEEREHAEKIMTY 80
            ::||:...||..:|..|.:.|.||::|::||.:|||.|::.....||||..|...:..||..|..
Mouse     8 MQQNYDWQCEDAINTHIQLCLYASYEYMSMAVYFDRDDVAQENFKRFFLTKSHNCQTSAEMFMHL 72

  Fly    81 MNKRGGLIILSSVPQP-LPCFASTLDALKHAMKMELEVNKHLLDLHALAGKEADPNLCDFIEANF 144
            .|||||...|..:.:| ...:.....|::.|..||:.:|:.||::|.:|.::.||:||.|:|.|.
Mouse    73 QNKRGGCSSLQGIARPERDSWHGGFQAMECAFHMEMLINQSLLNMHEVAKEKGDPHLCHFLEQNC 137

  Fly   145 LQEQVDGQKILADYISQLEK---AQNQVGEFLFDK 176
            |.:|||..|.::.|::.|.:   .::.:.|:||||
Mouse   138 LDQQVDILKEMSGYLTNLRQMGAVEHNLAEYLFDK 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer3HCHNP_572854.1 Euk_Ferritin 24..177 CDD:153114 57/157 (36%)
Ferritin 25..165 CDD:278632 51/143 (36%)
Fthl17eNP_112551.2 Euk_Ferritin 13..173 CDD:153114 57/160 (36%)
Ferritin 17..158 CDD:278632 51/140 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 126 1.000 Domainoid score I5380
eggNOG 1 0.900 - - E1_COG1528
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 139 1.000 Inparanoid score I4494
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249457at2759
OrthoFinder 1 1.000 - - FOG0000169
OrthoInspector 1 1.000 - - otm43954
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11431
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X152
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.970

Return to query results.
Submit another query.