DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer3HCH and FER1

DIOPT Version :9

Sequence 1:NP_572854.1 Gene:Fer3HCH / 32260 FlyBaseID:FBgn0030449 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_195780.1 Gene:FER1 / 831720 AraportID:AT5G01600 Length:255 Species:Arabidopsis thaliana


Alignment Length:169 Identity:65/169 - (38%)
Similarity:102/169 - (60%) Gaps:5/169 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LVRQNFAKSCEKKLNDQINMELKASHQYLAMAYHFDRSDISSPGMHRFFLKASVEEREHAEKIMT 79
            |.||.||.:.|..:|:|||:|...|:.|.:|..:|||.:::..|:.:||.::|.|||.||||.|.
plant    85 LARQRFADASEAVINEQINVEYNVSYVYHSMYAYFDRDNVAMKGLAKFFKESSEEERGHAEKFME 149

  Fly    80 YMNKRGGLIILSSVPQPLPCF-----ASTLDALKHAMKMELEVNKHLLDLHALAGKEADPNLCDF 139
            |.|:|||.:.|..:..|:..|     ...|.|::.|:.:|...|:.||::|.:|.:..||.|.||
plant   150 YQNQRGGRVKLHPIVSPISEFEHAEKGDALYAMELALSLEKLTNEKLLNVHKVASENNDPQLADF 214

  Fly   140 IEANFLQEQVDGQKILADYISQLEKAQNQVGEFLFDKYM 178
            :|:.||.||::..|.::|||:||.......|.:.||:.:
plant   215 VESEFLGEQIEAIKKISDYITQLRMIGKGHGVWHFDQML 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer3HCHNP_572854.1 Euk_Ferritin 24..177 CDD:153114 60/157 (38%)
Ferritin 25..165 CDD:278632 57/144 (40%)
FER1NP_195780.1 Euk_Ferritin 92..251 CDD:153114 59/158 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 125 1.000 Domainoid score I1790
eggNOG 1 0.900 - - E1_COG1528
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 139 1.000 Inparanoid score I1798
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249457at2759
OrthoFinder 1 1.000 - - FOG0000169
OrthoInspector 1 1.000 - - otm3022
orthoMCL 1 0.900 - - OOG6_100688
Panther 1 1.100 - - O PTHR11431
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X152
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.