DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer3HCH and AT3G61010

DIOPT Version :9

Sequence 1:NP_572854.1 Gene:Fer3HCH / 32260 FlyBaseID:FBgn0030449 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001319810.1 Gene:AT3G61010 / 825272 AraportID:AT3G61010 Length:427 Species:Arabidopsis thaliana


Alignment Length:49 Identity:18/49 - (36%)
Similarity:30/49 - (61%) Gaps:0/49 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 INMELKASHQYLAMAYHFDRSDISSPGMHRFFLKASVEEREHAEKIMTY 80
            |::|...|:.|.|:..:.:|.::...|..:||..:|:|||.:|||.|.|
plant   369 IDVEYNVSYVYHALDAYIERDNVGLKGFTKFFNDSSLEERGYAEKFMEY 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer3HCHNP_572854.1 Euk_Ferritin 24..177 CDD:153114 18/49 (37%)
Ferritin 25..165 CDD:278632 18/49 (37%)
AT3G61010NP_001319810.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.