DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer3HCH and FER4

DIOPT Version :9

Sequence 1:NP_572854.1 Gene:Fer3HCH / 32260 FlyBaseID:FBgn0030449 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_181559.1 Gene:FER4 / 818622 AraportID:AT2G40300 Length:259 Species:Arabidopsis thaliana


Alignment Length:190 Identity:72/190 - (37%)
Similarity:118/190 - (62%) Gaps:13/190 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FRDIRRHMCM--------LVRQNFAKSCEKKLNDQINMELKASHQYLAMAYHFDRSDISSPGMHR 61
            |:::::.:.:        |.||.::..||..:|:|||:|...|:.|.||..:|||.:|:..|:.:
plant    70 FKEVKKELDLVPTSSHLSLARQKYSDECEAAINEQINVEYNVSYVYHAMYAYFDRDNIALKGLAK 134

  Fly    62 FFLKASVEEREHAEKIMTYMNKRGGLIILSSVPQPLPCF-----ASTLDALKHAMKMELEVNKHL 121
            ||.::|:||||||||:|.|.|||||.:.|.|:..||..|     ...|..::.|:.:|..||:.|
plant   135 FFKESSLEEREHAEKLMEYQNKRGGRVKLQSIVMPLSEFEHVDKGDALYGMELALSLEKLVNEKL 199

  Fly   122 LDLHALAGKEADPNLCDFIEANFLQEQVDGQKILADYISQLEKAQNQVGEFLFDKYMGSG 181
            |:||::|.|..|.:|.||||:.||.|||:..|::::|::||.:.....|.:.|::.:..|
plant   200 LNLHSVASKNNDVHLADFIESEFLTEQVEAIKLISEYVAQLRRVGKGHGTWHFNQMLLEG 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer3HCHNP_572854.1 Euk_Ferritin 24..177 CDD:153114 67/157 (43%)
Ferritin 25..165 CDD:278632 64/144 (44%)
FER4NP_181559.1 Euk_Ferritin 94..254 CDD:153114 67/159 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 125 1.000 Domainoid score I1790
eggNOG 1 0.900 - - E1_COG1528
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 139 1.000 Inparanoid score I1798
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249457at2759
OrthoFinder 1 1.000 - - FOG0000169
OrthoInspector 1 1.000 - - otm3022
orthoMCL 1 0.900 - - OOG6_100688
Panther 1 1.100 - - LDO PTHR11431
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X152
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.