DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer3HCH and Ftmt

DIOPT Version :9

Sequence 1:NP_572854.1 Gene:Fer3HCH / 32260 FlyBaseID:FBgn0030449 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_080562.2 Gene:Ftmt / 67634 MGIID:1914884 Length:237 Species:Mus musculus


Alignment Length:173 Identity:77/173 - (44%)
Similarity:109/173 - (63%) Gaps:11/173 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VRQNFAKSCEKKLNDQINMELKASHQYLAMAYHFDRSDISSPGMHRFFLKASVEEREHAEKIMTY 80
            |||||....|..:|.|||:||.||:.||:|||:|.|.|::.....::||:.|:||||||||:|..
Mouse    64 VRQNFHPDSEAAINRQINLELYASYVYLSMAYYFSRDDVALYNFSKYFLRQSLEEREHAEKLMKL 128

  Fly    81 MNKRGGLIILSSVPQP----LPCFASTLDALKHAMKMELEVNKHLLDLHALAGKEADPNLCDFIE 141
            .|:|||.|.|..:.:|    ..|   .|.|::.|:.:|..||:.|||||.||.::.||:||||:|
Mouse   129 QNQRGGRICLQDIKKPDKDDWEC---GLRAMECALLLEKNVNQSLLDLHTLASEKGDPHLCDFLE 190

  Fly   142 ANFLQEQVDGQKILADYISQL---EKAQNQVGEFLFDKY-MGS 180
            .::|.|||...|.|.|::..|   ......:.|:||||: :||
Mouse   191 THYLHEQVKSIKELGDHVHNLVTMGAPAAGLAEYLFDKHTLGS 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer3HCHNP_572854.1 Euk_Ferritin 24..177 CDD:153114 69/159 (43%)
Ferritin 25..165 CDD:278632 65/146 (45%)
FtmtNP_080562.2 Euk_Ferritin 69..229 CDD:153114 69/162 (43%)
Ferritin 73..211 CDD:278632 64/140 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833001
Domainoid 1 1.000 126 1.000 Domainoid score I5380
eggNOG 1 0.900 - - E1_COG1528
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H110661
Inparanoid 1 1.050 139 1.000 Inparanoid score I4494
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249457at2759
OrthoFinder 1 1.000 - - FOG0000169
OrthoInspector 1 1.000 - - otm43954
orthoMCL 1 0.900 - - OOG6_100688
Panther 1 1.100 - - O PTHR11431
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4342
SonicParanoid 1 1.000 - - X152
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1514.830

Return to query results.
Submit another query.