DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer3HCH and zgc:172145

DIOPT Version :9

Sequence 1:NP_572854.1 Gene:Fer3HCH / 32260 FlyBaseID:FBgn0030449 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001119864.1 Gene:zgc:172145 / 559095 ZFINID:ZDB-GENE-080516-9 Length:202 Species:Danio rerio


Alignment Length:175 Identity:46/175 - (26%)
Similarity:88/175 - (50%) Gaps:21/175 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VRQNFAKSCEKKLNDQINMELKASHQYLAMAYHFDRSDISSPGMHRFFLKASVEEREHAEKIMTY 80
            |:|||.:..|:.|.....:.|:.|::..|:...|::|:::.|.:..:|.:.||:|:|.||.::.|
Zfish    27 VKQNFPRVVEESLCGVSTLLLEVSYKLEALGRIFEQSNLALPRVAAYFHQESVKEQERAEVMLQY 91

  Fly    81 MNKRGGLIILSSVPQP--------LPCFASTLDALKHAMKMELEVNKHLLDLHALAGKEADPNLC 137
            :::|||.....::.:|        ||.....|:..|..|.:.||:|.       ||.:..||:..
Zfish    92 LSQRGGKYCNKNIQRPGTEQVCAVLPALEIMLNQWKEEMSVMLEINH-------LAHEHDDPHTA 149

  Fly   138 DFIEANFLQEQVDGQKILADYISQLEK------AQNQVGEFLFDK 176
            ..|::.|::..|...|::.|.::...:      :....||||.|:
Zfish   150 SVIKSQFIEPLVQKVKLVGDLLTNARRVGCTDDSAAGFGEFLIDQ 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer3HCHNP_572854.1 Euk_Ferritin 24..177 CDD:153114 42/167 (25%)
Ferritin 25..165 CDD:278632 37/153 (24%)
zgc:172145NP_001119864.1 Ferritin_like 35..195 CDD:294190 42/167 (25%)
Ferritin 44..177 CDD:278632 35/139 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575714
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249457at2759
OrthoFinder 1 1.000 - - FOG0000169
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100688
Panther 1 1.100 - - O PTHR11431
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.