DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer3HCH and fthl31

DIOPT Version :9

Sequence 1:NP_572854.1 Gene:Fer3HCH / 32260 FlyBaseID:FBgn0030449 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001018367.1 Gene:fthl31 / 553552 ZFINID:ZDB-GENE-050522-428 Length:175 Species:Danio rerio


Alignment Length:165 Identity:75/165 - (45%)
Similarity:110/165 - (66%) Gaps:4/165 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VRQNFAKSCEKKLNDQINMELKASHQYLAMAYHFDRSDISSPGMHRFFLKASVEEREHAEKIMTY 80
            :|||:.:..|..:|..||:||.|.:.|.:||::|.|.|::.||..:||.|.|.||||||||.|.:
Zfish     6 IRQNYVRDSEAAINKMINLELYAGYTYTSMAHYFKRDDVALPGFAKFFKKNSEEEREHAEKFMEF 70

  Fly    81 MNKRGGLIILSSVPQP-LPCFASTLDALKHAMKMELEVNKHLLDLHALAGKEADPNLCDFIEANF 144
            .|||||.|:|..:.:| ...:.:.|.|::.|:::|..||:.|||||.||.:..||:||||:|.::
Zfish    71 QNKRGGRIVLQDIKKPDRDVWGNGLIAMQCALQLEKNVNQALLDLHKLATEMGDPHLCDFLETHY 135

  Fly   145 LQEQVDGQKILADYISQLEK---AQNQVGEFLFDK 176
            |.|||:..|.|.|:|:.|.|   ..|::.|:||||
Zfish   136 LNEQVEAIKKLGDHITNLSKMDAGNNRMAEYLFDK 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer3HCHNP_572854.1 Euk_Ferritin 24..177 CDD:153114 72/157 (46%)
Ferritin 25..165 CDD:278632 66/143 (46%)
fthl31NP_001018367.1 Euk_Ferritin 13..170 CDD:153114 70/156 (45%)
Ferritin 15..156 CDD:278632 65/140 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 134 1.000 Domainoid score I4949
eggNOG 1 0.900 - - E1_COG1528
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H110661
Inparanoid 1 1.050 157 1.000 Inparanoid score I4247
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249457at2759
OrthoFinder 1 1.000 - - FOG0000169
OrthoInspector 1 1.000 - - otm24874
orthoMCL 1 0.900 - - OOG6_100688
Panther 1 1.100 - - O PTHR11431
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X152
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1312.870

Return to query results.
Submit another query.