DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer3HCH and Ftl1l1

DIOPT Version :9

Sequence 1:NP_572854.1 Gene:Fer3HCH / 32260 FlyBaseID:FBgn0030449 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_038956243.1 Gene:Ftl1l1 / 501644 RGDID:1561055 Length:183 Species:Rattus norvegicus


Alignment Length:176 Identity:61/176 - (34%)
Similarity:106/176 - (60%) Gaps:12/176 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 MCMLVRQNFAKSCEKKLNDQINMELKASHQYLAMAYHFDRSDISSPGMHRFFLKASVEEREHAEK 76
            |...:|||::...|..:|..:|:.|:||:.||::.:.|||.|::..|:..||.:.:.|:||.||.
  Rat     1 MTSQIRQNYSTEVEAAVNRLVNLHLRASYTYLSLGFFFDRDDVALEGVGHFFGELAEEKREGAEH 65

  Fly    77 IMTYMNKRGGLIILSSVPQPLPC-FASTLDALKHAMKMELEVNKHLLDLHALAGKEADPNLCDFI 140
            ::...|:|||..:...|.:|... :..||:|::.|:.:|..:|:.|||||||.....||:||||:
  Rat    66 LLKLQNERGGRALFQDVQKPSQDEWGKTLEAMEAALALEKNLNQALLDLHALGSAHTDPHLCDFL 130

  Fly   141 EANFLQEQVDGQKILADYISQLEK-----------AQNQVGEFLFD 175
            |::||.::|...|.:.::::.|.:           ||..:||:||:
  Rat   131 ESHFLDKEVKLIKKMGNHLTNLRRVAGLQPEQTGVAQASLGEYLFE 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer3HCHNP_572854.1 Euk_Ferritin 24..177 CDD:153114 57/164 (35%)
Ferritin 25..165 CDD:278632 51/151 (34%)
Ftl1l1XP_038956243.1 Ferritin 10..176 CDD:153098 56/165 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336568
Domainoid 1 1.000 127 1.000 Domainoid score I5229
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 141 1.000 Inparanoid score I4396
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000169
OrthoInspector 1 1.000 - - otm46042
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11431
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X152
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.990

Return to query results.
Submit another query.