DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer3HCH and RGD1560687

DIOPT Version :9

Sequence 1:NP_572854.1 Gene:Fer3HCH / 32260 FlyBaseID:FBgn0030449 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_038935980.1 Gene:RGD1560687 / 500804 RGDID:1560687 Length:183 Species:Rattus norvegicus


Alignment Length:177 Identity:58/177 - (32%)
Similarity:105/177 - (59%) Gaps:12/177 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 MCMLVRQNFAKSCEKKLNDQINMELKASHQYLAMAYHFDRSDISSPGMHRFFLKASVEEREHAEK 76
            |...:|||::...|..:|..:|:..:||:.||::.:.|||.|::..|:..||.:.:.|:||.|::
  Rat     1 MTSQIRQNYSTEVEAAVNRLVNLHPRASYTYLSLGFFFDRDDVALEGVGHFFRELAEEKREGAQR 65

  Fly    77 IMTYMNKRGGLIILSSVPQPLPC-FASTLDALKHAMKMELEVNKHLLDLHALAGKEADPNLCDFI 140
            ::...|:.||..:...|.:|... :..||:|::.|:.:|..:|:.|||||||.....||:||||:
  Rat    66 LLKLQNELGGRALFQDVQKPSQDEWGKTLEAMEAALALEKNLNQALLDLHALGSARTDPHLCDFL 130

  Fly   141 EANFLQEQVDGQKILADYISQLEK-----------AQNQVGEFLFDK 176
            |.:||.::|...|.:.::::.|.:           ||..:||:||::
  Rat   131 ERHFLDKEVKLSKKMGNHLTNLRRVAGPQPAQTGVAQASLGEYLFER 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer3HCHNP_572854.1 Euk_Ferritin 24..177 CDD:153114 54/165 (33%)
Ferritin 25..165 CDD:278632 48/151 (32%)
RGD1560687XP_038935980.1 Ferritin 10..177 CDD:153098 54/166 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336570
Domainoid 1 1.000 127 1.000 Domainoid score I5229
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 141 1.000 Inparanoid score I4396
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000169
OrthoInspector 1 1.000 - - otm46042
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11431
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X152
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.990

Return to query results.
Submit another query.