DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer3HCH and ftmt

DIOPT Version :9

Sequence 1:NP_572854.1 Gene:Fer3HCH / 32260 FlyBaseID:FBgn0030449 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001005135.1 Gene:ftmt / 448718 XenbaseID:XB-GENE-955502 Length:177 Species:Xenopus tropicalis


Alignment Length:166 Identity:77/166 - (46%)
Similarity:113/166 - (68%) Gaps:4/166 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VRQNFAKSCEKKLNDQINMELKASHQYLAMAYHFDRSDISSPGMHRFFLKASVEEREHAEKIMTY 80
            ||||:.:.||..:|.|:||||.||:.||:|||:|||.|::.....::||..|.||||||||:|..
 Frog     5 VRQNYHQECEAAINRQVNMELYASYVYLSMAYYFDRDDVALKNFSKYFLHQSHEEREHAEKLMKM 69

  Fly    81 MNKRGGLIILSSVPQP-LPCFASTLDALKHAMKMELEVNKHLLDLHALAGKEADPNLCDFIEANF 144
            .|:|||.|.|..|.:| ...:|:.|:||:.::::|..||:.||:||.|:....||:||||:|:::
 Frog    70 QNQRGGRIFLQDVKKPDRDEWANGLEALECSLQLEKSVNQSLLELHKLSTDHNDPHLCDFLESHY 134

  Fly   145 LQEQVDGQKILADYISQLEK---AQNQVGEFLFDKY 177
            |.|||...|.|.|:|:.|.:   ..|.:.|:||||:
 Frog   135 LDEQVKSMKELGDHITNLRRMGAPSNGMAEYLFDKH 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer3HCHNP_572854.1 Euk_Ferritin 24..177 CDD:153114 72/156 (46%)
Ferritin 25..165 CDD:278632 66/143 (46%)
ftmtNP_001005135.1 Euk_Ferritin 10..170 CDD:153114 72/159 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 130 1.000 Domainoid score I5141
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 151 1.000 Inparanoid score I4249
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249457at2759
OrthoFinder 1 1.000 - - FOG0000169
OrthoInspector 1 1.000 - - otm49128
Panther 1 1.100 - - LDO PTHR11431
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4342
SonicParanoid 1 1.000 - - X152
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.100

Return to query results.
Submit another query.