DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer3HCH and fth1b

DIOPT Version :9

Sequence 1:NP_572854.1 Gene:Fer3HCH / 32260 FlyBaseID:FBgn0030449 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001004562.1 Gene:fth1b / 447823 ZFINID:ZDB-GENE-040912-30 Length:177 Species:Danio rerio


Alignment Length:170 Identity:77/170 - (45%)
Similarity:110/170 - (64%) Gaps:4/170 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 MCMLVRQNFAKSCEKKLNDQINMELKASHQYLAMAYHFDRSDISSPGMHRFFLKASVEEREHAEK 76
            |...|||||.:.||..:|.||.:||.||:.||:|.|:|||.|.|.|...:||...|.||||||||
Zfish     1 MSSQVRQNFHQECEAAINRQIYLELYASYVYLSMGYYFDRDDKSLPNFAKFFRDQSKEEREHAEK 65

  Fly    77 IMTYMNKRGGLIILSSVPQP-LPCFASTLDALKHAMKMELEVNKHLLDLHALAGKEADPNLCDFI 140
            :|:..|:|||.|.|..:.:| ...:.|.|:||:.|:.:|..||..||:||.:|.:..||::|||:
Zfish    66 LMSLQNQRGGRIFLQDIKKPDRDEWGSGLEALECALALEKSVNLSLLELHKVATQHNDPHVCDFL 130

  Fly   141 EANFLQEQVDGQKILADYISQLEK---AQNQVGEFLFDKY 177
            |.::|.|||...|.|:|::..|.:   .||.:.|:|||::
Zfish   131 ETHYLDEQVKSIKELSDWVGSLRRMGAPQNNMAEYLFDRH 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer3HCHNP_572854.1 Euk_Ferritin 24..177 CDD:153114 71/156 (46%)
Ferritin 25..165 CDD:278632 64/143 (45%)
fth1bNP_001004562.1 Euk_Ferritin 10..170 CDD:153114 71/159 (45%)
Ferritin 14..155 CDD:278632 64/140 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 134 1.000 Domainoid score I4949
eggNOG 1 0.900 - - E1_COG1528
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 157 1.000 Inparanoid score I4247
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249457at2759
OrthoFinder 1 1.000 - - FOG0000169
OrthoInspector 1 1.000 - - otm24874
orthoMCL 1 0.900 - - OOG6_100688
Panther 1 1.100 - - O PTHR11431
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X152
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1110.870

Return to query results.
Submit another query.