DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer3HCH and zgc:56095

DIOPT Version :9

Sequence 1:NP_572854.1 Gene:Fer3HCH / 32260 FlyBaseID:FBgn0030449 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_998178.1 Gene:zgc:56095 / 406286 ZFINID:ZDB-GENE-040426-1948 Length:179 Species:Danio rerio


Alignment Length:169 Identity:61/169 - (36%)
Similarity:105/169 - (62%) Gaps:6/169 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LVRQNFAKSCEKKLNDQINMELKASHQYLAMAYHFDRSDISSPGMHRFFLKASVEEREHAEKIMT 79
            |::||...:.|..:|..||::|.||:.||::..:|||.|::.|...:|||:.|.:||:|||.::.
Zfish     3 LIKQNLHSNNEANINKLINLKLTASYVYLSLGMYFDRDDVALPNFPKFFLERSHKERDHAEDLLE 67

  Fly    80 YMNKRGGLIILSSVPQP-LPCFASTLDALKHAMKMELEVNKHLLDLHALAGKEADPNLCDFIEAN 143
            |.|.|||.|:|.:|.:| ...:...:|||..:::.:..:|:.||::|.:||:.:||:|.||:|..
Zfish    68 YQNTRGGRILLQTVAKPSRDDWKGGIDALAFSLEHQKSINRSLLEVHRVAGEHSDPHLSDFLEGK 132

  Fly   144 FLQEQVDGQKILADYISQLEK-----AQNQVGEFLFDKY 177
            |..:..:..|.|.||:..|.:     ...::.|:||||:
Zfish   133 FFTDSHETIKTLGDYLGSLSRITSSDPHGKMAEYLFDKH 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer3HCHNP_572854.1 Euk_Ferritin 24..177 CDD:153114 57/158 (36%)
Ferritin 25..165 CDD:278632 53/145 (37%)
zgc:56095NP_998178.1 Euk_Ferritin 9..171 CDD:153114 57/161 (35%)
Ferritin 13..154 CDD:278632 53/140 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575713
Domainoid 1 1.000 134 1.000 Domainoid score I4949
eggNOG 1 0.900 - - E1_COG1528
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 157 1.000 Inparanoid score I4247
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249457at2759
OrthoFinder 1 1.000 - - FOG0000169
OrthoInspector 1 1.000 - - otm24874
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11431
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X152
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.860

Return to query results.
Submit another query.