DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer3HCH and MGC75752

DIOPT Version :9

Sequence 1:NP_572854.1 Gene:Fer3HCH / 32260 FlyBaseID:FBgn0030449 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_989212.1 Gene:MGC75752 / 394820 -ID:- Length:178 Species:Xenopus tropicalis


Alignment Length:165 Identity:60/165 - (36%)
Similarity:109/165 - (66%) Gaps:4/165 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VRQNFAKSCEKKLNDQINMELKASHQYLAMAYHFDRSDISSPGMHRFFLKASVEEREHAEKIMTY 80
            :|||:.:..|..:|...|:||:.|:.||::.|:|||.|::.....:::.:.|.::|:|||.::.:
 Frog     7 IRQNYHEESEAGINRIANLELQTSYVYLSLGYYFDRDDVALSKFSKYYRELSEKKRDHAEDLLKF 71

  Fly    81 MNKRGGLIILSSVPQP-LPCFASTLDALKHAMKMELEVNKHLLDLHALAGKEADPNLCDFIEANF 144
            .|||||.::|..:.:| ...:.:...|::.|:.:|..||:.|||||.:|...|||::||::|..|
 Frog    72 QNKRGGRVVLQDIKKPDADEWGNGTKAMEVALNLEKSVNQALLDLHKIATDHADPHMCDYLEREF 136

  Fly   145 LQEQVDGQKILADYISQLEK---AQNQVGEFLFDK 176
            |:|:|...|.|.|:::.|::   |::.:||:||||
 Frog   137 LEEEVKIIKKLGDHLTNLKRVKAAEDGMGEYLFDK 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer3HCHNP_572854.1 Euk_Ferritin 24..177 CDD:153114 57/157 (36%)
Ferritin 25..165 CDD:278632 50/143 (35%)
MGC75752NP_989212.1 Euk_Ferritin 12..172 CDD:153114 57/160 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 130 1.000 Domainoid score I5141
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 151 1.000 Inparanoid score I4249
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249457at2759
OrthoFinder 1 1.000 - - FOG0000169
OrthoInspector 1 1.000 - - otm49128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X152
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.