DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer3HCH and fth1.1

DIOPT Version :9

Sequence 1:NP_572854.1 Gene:Fer3HCH / 32260 FlyBaseID:FBgn0030449 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_989008.1 Gene:fth1.1 / 394604 XenbaseID:XB-GENE-5742862 Length:176 Species:Xenopus tropicalis


Alignment Length:166 Identity:80/166 - (48%)
Similarity:116/166 - (69%) Gaps:4/166 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VRQNFAKSCEKKLNDQINMELKASHQYLAMAYHFDRSDISSPGMHRFFLKASVEEREHAEKIMTY 80
            |||||...||..:|..:||||.||:.||:|:|:|||.|::...:.:||.:.|.||||||||.:.|
 Frog     5 VRQNFNSDCEAAINRMVNMELYASYVYLSMSYYFDRDDVALHHVAKFFKEQSHEEREHAEKFLKY 69

  Fly    81 MNKRGGLIILSSVPQP-LPCFASTLDALKHAMKMELEVNKHLLDLHALAGKEADPNLCDFIEANF 144
            .|||||..:|..:.:| ...:.:||:|::.|:::|..||:.|||||.||..:.||:||||:|:.:
 Frog    70 QNKRGGRAVLQDIKKPERDEWGNTLEAMQAALQLEKTVNQALLDLHKLASDKTDPHLCDFLESEY 134

  Fly   145 LQEQVDGQKILADYISQLEK---AQNQVGEFLFDKY 177
            |:|||...|.|.|||:.|::   .||.:||:||||:
 Frog   135 LEEQVKAMKELGDYITNLKRLGVPQNGMGEYLFDKH 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer3HCHNP_572854.1 Euk_Ferritin 24..177 CDD:153114 74/156 (47%)
Ferritin 25..165 CDD:278632 66/143 (46%)
fth1.1NP_989008.1 Euk_Ferritin 10..170 CDD:153114 74/159 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249457at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.