DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer3HCH and Ftdc1

DIOPT Version :9

Sequence 1:NP_572854.1 Gene:Fer3HCH / 32260 FlyBaseID:FBgn0030449 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001028576.1 Gene:Ftdc1 / 328695 MGIID:2685659 Length:176 Species:Mus musculus


Alignment Length:144 Identity:36/144 - (25%)
Similarity:65/144 - (45%) Gaps:12/144 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 INMELKASHQYLAMAYHFDRSDISSPGMHRFFLKASVEEREHAEKIMTYMNKRGGLIILSSVPQP 96
            :.|.|..::.:||..|. |.:.::|.|.:... |||| :..:|::|:.|:.:||..:.:..:.:|
Mouse    23 MQMNLSDAYMFLACLYS-DDTTMTSFGAYSQD-KASV-KWFYAKRILAYITERGNKVCIPEIQRP 84

  Fly    97 ----LPCFASTLDALKHAMKMELEVNKHLLDLHALAGKEADPNLCDFIEANFLQEQVDGQKILAD 157
                ..|....:|.|    .||.|:.:.|.||..:|....|.....|.: ..:..|...:..||.
Mouse    85 EIDTQGCIQCAIDIL----NMENELTEILHDLQDVALTVKDNTTITFTK-ELIYTQRRNEDRLAL 144

  Fly   158 YISQLEKAQNQVGE 171
            .|.:|.:.:....|
Mouse   145 EIVELRRKEKLAQE 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer3HCHNP_572854.1 Euk_Ferritin 24..177 CDD:153114 36/144 (25%)
Ferritin 25..165 CDD:278632 35/136 (26%)
Ftdc1NP_001028576.1 Ferritin_like 11..154 CDD:294190 35/138 (25%)
Ferritin 14..151 CDD:278632 35/135 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833000
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11431
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.