DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer3HCH and Ripor2

DIOPT Version :9

Sequence 1:NP_572854.1 Gene:Fer3HCH / 32260 FlyBaseID:FBgn0030449 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001014031.2 Gene:Ripor2 / 306934 RGDID:1306939 Length:1310 Species:Rattus norvegicus


Alignment Length:177 Identity:53/177 - (29%)
Similarity:93/177 - (52%) Gaps:35/177 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 MCMLVRQNFAKSCEKKLNDQINMELKASHQYLAMAYHFDRSDISSPGMHRFFLKASVEEREHAEK 76
            |...:|||::...|..:|..:|:.|:||:.||::.:.||..|::..|                  
  Rat  1151 MTSQIRQNYSTEVEAAVNRLVNLHLRASYTYLSLGFFFDPDDVALEG------------------ 1197

  Fly    77 IMTYMNKRGGLIILSSVPQPLPC-FASTLDALKHAMKMELEVNKHLLDLHALAGKEADPNLCDFI 140
                 |:|||..:...|.:|... :..||:|::.|:.:|..:|:.|||||||.....||:||||:
  Rat  1198 -----NERGGRALFQDVQKPSQDEWGKTLEAMEAALALEKNLNQALLDLHALGSARTDPHLCDFL 1257

  Fly   141 EANFLQEQVDGQKILADYISQLEK-----------AQNQVGEFLFDK 176
            |::||.::|...|.:.::::.|.:           ||..:||:||::
  Rat  1258 ESHFLDKEVKLIKKMGNHLTNLRRVAGPQPAQTGVAQASLGEYLFER 1304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer3HCHNP_572854.1 Euk_Ferritin 24..177 CDD:153114 49/165 (30%)
Ferritin 25..165 CDD:278632 43/151 (28%)
Ripor2NP_001014031.2 PL48 118..529 CDD:292525
Involved in cell filopodia formation. /evidence=ECO:0000250|UniProtKB:Q9Y4F9 196..254
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 588..639
PI-PLCc_GDPD_SF <963..>1097 CDD:301322
Ferritin_like 1160..1304 CDD:294190 49/166 (30%)
Ferritin 1164..1282 CDD:278632 43/140 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46042
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.