DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer3HCH and RGD1563378

DIOPT Version :9

Sequence 1:NP_572854.1 Gene:Fer3HCH / 32260 FlyBaseID:FBgn0030449 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_038956266.1 Gene:RGD1563378 / 302719 RGDID:1563378 Length:176 Species:Rattus norvegicus


Alignment Length:165 Identity:61/165 - (36%)
Similarity:99/165 - (60%) Gaps:4/165 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VRQNFAKSCEKKLNDQINMELKASHQYLAMAYHFDRSDISSPGMHRFFLKASVEEREHAEKIMTY 80
            ||||:.:.||..:|:.|.:.|:||:.||:||::|||.|::.....||||..|...:..||..:..
  Rat     8 VRQNYDRCCEDAINNHIRLLLQASYSYLSMAFYFDRDDVALGNFKRFFLSKSHNCKASAEMFVFM 72

  Fly    81 MNKRGGLIILSSVPQP-LPCFASTLDALKHAMKMELEVNKHLLDLHALAGKEADPNLCDFIEANF 144
            .|||||.:.|.|:.:| ...:...|.|::.|.:||:.:|:.||::|.||..:.|.:||||:..:.
  Rat    73 QNKRGGHVFLPSIAKPDRESWHGGLRAMECAFRMEMTINQSLLNMHELAKGKDDAHLCDFLGQHC 137

  Fly   145 LQEQVDGQKILADYISQLEK---AQNQVGEFLFDK 176
            |.:||...|.:..|::.|.:   .:..:.|:||||
  Rat   138 LDQQVHVLKKMGGYLTNLRQMGAPEQGLAEYLFDK 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer3HCHNP_572854.1 Euk_Ferritin 24..177 CDD:153114 57/157 (36%)
Ferritin 25..165 CDD:278632 51/143 (36%)
RGD1563378XP_038956266.1 Euk_Ferritin 16..173 CDD:153114 57/157 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 127 1.000 Domainoid score I5229
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 141 1.000 Inparanoid score I4396
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249457at2759
OrthoFinder 1 1.000 - - FOG0000169
OrthoInspector 1 1.000 - - otm46042
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11431
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X152
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.070

Return to query results.
Submit another query.