DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer3HCH and RGD1561106

DIOPT Version :9

Sequence 1:NP_572854.1 Gene:Fer3HCH / 32260 FlyBaseID:FBgn0030449 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_038956363.1 Gene:RGD1561106 / 302548 RGDID:1561106 Length:216 Species:Rattus norvegicus


Alignment Length:174 Identity:60/174 - (34%)
Similarity:103/174 - (59%) Gaps:7/174 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VRQNFAKSCEKKLNDQINMELKASHQYLAMAYHFDRSDISSPGMHRFFLKASVEEREHAEKIMTY 80
            |||||...||..:|..:.::|..|:.||:|.::|||.|::.....|:||..|.|...:||..:..
  Rat    42 VRQNFHTDCEAAINRHVRLQLSTSYVYLSMCFYFDREDVALENFSRYFLNKSHECTRNAEIFLAL 106

  Fly    81 MNKRGGLIILSSVPQPLPC--FASTLDALKHAMKMELEVNKHLLDLHALAGKEADPNLCDFIEAN 143
            .|:|||.|.|.::.:| .|  :...|.|::.|.::||.:|:.|:.::.||.::.|.:||.|::.:
  Rat   107 QNQRGGRISLRTIYKP-DCDNWIGGLPAMERAFQLELHLNQSLVAMYQLAARKRDGHLCSFLQTH 170

  Fly   144 FLQEQVDGQKILADY-ISQLEKAQNQVG--EFLFDKYMGSGMHP 184
            ||::||...|.::.: ||..:....:||  |:||.| :..|.:|
  Rat   171 FLRKQVAVLKEMSSFLISMRQMGSPEVGMAEYLFGK-LSLGDNP 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer3HCHNP_572854.1 Euk_Ferritin 24..177 CDD:153114 52/157 (33%)
Ferritin 25..165 CDD:278632 46/142 (32%)
RGD1561106XP_038956363.1 Euk_Ferritin 47..207 CDD:153114 53/161 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11431
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.