DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer3HCH and FTL

DIOPT Version :9

Sequence 1:NP_572854.1 Gene:Fer3HCH / 32260 FlyBaseID:FBgn0030449 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_000137.2 Gene:FTL / 2512 HGNCID:3999 Length:175 Species:Homo sapiens


Alignment Length:169 Identity:61/169 - (36%)
Similarity:106/169 - (62%) Gaps:4/169 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 MCMLVRQNFAKSCEKKLNDQINMELKASHQYLAMAYHFDRSDISSPGMHRFFLKASVEEREHAEK 76
            |...:|||::...|..:|..:|:.|:||:.||::.::|||.|::..|:..||.:.:.|:||..|:
Human     1 MSSQIRQNYSTDVEAAVNSLVNLYLQASYTYLSLGFYFDRDDVALEGVSHFFRELAEEKREGYER 65

  Fly    77 IMTYMNKRGGLIILSSVPQPLPC-FASTLDALKHAMKMELEVNKHLLDLHALAGKEADPNLCDFI 140
            ::...|:|||..:...:.:|... :..|.||:|.||.:|.::|:.|||||||.....||:||||:
Human    66 LLKMQNQRGGRALFQDIKKPAEDEWGKTPDAMKAAMALEKKLNQALLDLHALGSARTDPHLCDFL 130

  Fly   141 EANFLQEQVDGQKILADYISQLEK---AQNQVGEFLFDK 176
            |.:||.|:|...|.:.|:::.|.:   .:..:||:||::
Human   131 ETHFLDEEVKLIKKMGDHLTNLHRLGGPEAGLGEYLFER 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer3HCHNP_572854.1 Euk_Ferritin 24..177 CDD:153114 57/157 (36%)
Ferritin 25..165 CDD:278632 53/143 (37%)
FTLNP_000137.2 Ferritin 10..169 CDD:153098 57/158 (36%)
Catalytic site for iron oxidation 54..61 1/6 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142875
Domainoid 1 1.000 128 1.000 Domainoid score I5305
eggNOG 1 0.900 - - E1_COG1528
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 144 1.000 Inparanoid score I4447
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249457at2759
OrthoFinder 1 1.000 - - FOG0000169
OrthoInspector 1 1.000 - - otm41906
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11431
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X152
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1110.900

Return to query results.
Submit another query.