DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer3HCH and ftn-1

DIOPT Version :9

Sequence 1:NP_572854.1 Gene:Fer3HCH / 32260 FlyBaseID:FBgn0030449 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_504944.2 Gene:ftn-1 / 179138 WormBaseID:WBGene00001500 Length:170 Species:Caenorhabditis elegans


Alignment Length:163 Identity:62/163 - (38%)
Similarity:99/163 - (60%) Gaps:1/163 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LVRQNFAKSCEKKLNDQINMELKASHQYLAMAYHFDRSDISSPGMHRFFLKASVEEREHAEKIMT 79
            |.|||:....|..:|.|||:||.||:.||:|:.||||.||:...:.:||.:.|.|||.||.::|.
 Worm     3 LARQNYHDEVEAAVNKQINVELYASYVYLSMSAHFDRDDIALRNIAKFFKEQSDEERGHATELMR 67

  Fly    80 YMNKRGGLIILSSVPQP-LPCFASTLDALKHAMKMELEVNKHLLDLHALAGKEADPNLCDFIEAN 143
            ....|||.:.:.::.:| ...:.:.|:|.:.|:.:|...|..||.||.:|.:..|.:|.::|:..
 Worm    68 IQAVRGGRVAMQNIQKPEKDEWGTVLEAFEAALALERANNASLLKLHGIAEQRNDAHLTNYIQEK 132

  Fly   144 FLQEQVDGQKILADYISQLEKAQNQVGEFLFDK 176
            :|:|||......|.||:.:::|...:||:||||
 Worm   133 YLEEQVHSINEFARYIANIKRAGPGLGEYLFDK 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer3HCHNP_572854.1 Euk_Ferritin 24..177 CDD:153114 58/154 (38%)
Ferritin 25..165 CDD:278632 51/140 (36%)
ftn-1NP_504944.2 Euk_Ferritin 9..166 CDD:153114 58/157 (37%)
Ferritin 13..154 CDD:278632 51/140 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157381
Domainoid 1 1.000 105 1.000 Domainoid score I4165
eggNOG 1 0.900 - - E1_COG1528
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 125 1.000 Inparanoid score I3276
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48328
OrthoDB 1 1.010 - - D1249457at2759
OrthoFinder 1 1.000 - - FOG0000169
OrthoInspector 1 1.000 - - otm14386
orthoMCL 1 0.900 - - OOG6_100688
Panther 1 1.100 - - O PTHR11431
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X152
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.770

Return to query results.
Submit another query.