DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer3HCH and LOC108352322

DIOPT Version :9

Sequence 1:NP_572854.1 Gene:Fer3HCH / 32260 FlyBaseID:FBgn0030449 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_038944683.1 Gene:LOC108352322 / 108352322 RGDID:11424835 Length:182 Species:Rattus norvegicus


Alignment Length:155 Identity:40/155 - (25%)
Similarity:69/155 - (44%) Gaps:31/155 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 INMELKASHQYLAMAYHFDRSDISSPGMHRFFLKASVEEREHAEKIMTYMNKRGGLIILSSVPQP 96
            |.|.|..::.||...|   ..|.::.|...:....|:....:|:.::.|:..||..:.:..:.:|
  Rat    23 IQMNLSDAYLYLTYLY---SDDSTATGFGAYVQDKSLTSWFYAQSVLKYITGRGNKVCIPDIQRP 84

  Fly    97 -------LPCFASTLDALKHAMKMELEVNKH-LLDLHALAGKEADPNLCDFIEAN----FLQEQV 149
                   :.|..:.|:     |:.||:|..| |||| ||       |:.|....|    ::.:|.
  Rat    85 EIDTQGRIQCAMAALN-----MEKELKVILHRLLDL-AL-------NIKDNQTLNHSKDWIFKQQ 136

  Fly   150 DGQKILADYISQL---EKAQNQVGE 171
            ..::.||..|.:|   |:|||:..|
  Rat   137 RNEERLAREIDELKKKEQAQNRAVE 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer3HCHNP_572854.1 Euk_Ferritin 24..177 CDD:153114 40/155 (26%)
Ferritin 25..165 CDD:278632 36/147 (24%)
LOC108352322XP_038944683.1 Euk_Ferritin 10..157 CDD:153114 37/149 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336578
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11431
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.