DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer3HCH and LOC102549852

DIOPT Version :9

Sequence 1:NP_572854.1 Gene:Fer3HCH / 32260 FlyBaseID:FBgn0030449 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_038952292.1 Gene:LOC102549852 / 102549852 RGDID:7625414 Length:134 Species:Rattus norvegicus


Alignment Length:173 Identity:43/173 - (24%)
Similarity:76/173 - (43%) Gaps:59/173 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 MCMLVRQNFAKSCEKKLNDQINMELKASHQYLAMAYHFDRSDISSPGMHRFFLKASVEEREHAEK 76
            |...:|||::...|..:|..:|:.|:|   ||::.:.|||.|::..|:..||.:.:.|:      
  Rat     1 MTSQIRQNYSTEVEAAVNRLVNLHLRA---YLSLGFFFDRDDVALEGVGHFFCELAKEK------ 56

  Fly    77 IMTYMNKRGGLIILSSVPQPLPCFASTLDALKHAMKMELEVNKHLLDLHALAGKEADPNLCDFIE 141
                                                   .:|:.||:||||.....||:||||:|
  Rat    57 ---------------------------------------NLNQALLNLHALGSARIDPHLCDFLE 82

  Fly   142 ANFLQEQVDGQKILADYISQLEK-----------AQNQVGEFL 173
            ::||.::|...|.:.::::.|.:           ||..:||:|
  Rat    83 SHFLDKEVKLIKKMGNHLTNLRRVAGPQPAQTGVAQASLGEYL 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer3HCHNP_572854.1 Euk_Ferritin 24..177 CDD:153114 39/161 (24%)
Ferritin 25..165 CDD:278632 34/150 (23%)
LOC102549852XP_038952292.1 Ferritin_like 10..127 CDD:412271 39/164 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336575
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000169
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X152
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.