DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer3HCH and fthl29

DIOPT Version :9

Sequence 1:NP_572854.1 Gene:Fer3HCH / 32260 FlyBaseID:FBgn0030449 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001124139.1 Gene:fthl29 / 100170833 ZFINID:ZDB-GENE-080722-16 Length:175 Species:Danio rerio


Alignment Length:166 Identity:73/166 - (43%)
Similarity:111/166 - (66%) Gaps:4/166 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VRQNFAKSCEKKLNDQINMELKASHQYLAMAYHFDRSDISSPGMHRFFLKASVEEREHAEKIMTY 80
            :|||:...||..:|..||:||.|.:.|.:||::|.|.|::.||..:||...|.||||||||.|.:
Zfish     6 IRQNYDSDCEALINKMINLELYAGYTYTSMAHYFKRDDVALPGFAKFFKNNSEEEREHAEKFMEF 70

  Fly    81 MNKRGGLIILSSVPQP-LPCFASTLDALKHAMKMELEVNKHLLDLHALAGKEADPNLCDFIEANF 144
            .|||||.|:|..:.:| ...:.:.|.|::.|:::|..||:.|||||.:|.::.||:|||.:|:::
Zfish    71 QNKRGGRIVLQDIKKPGRDVWDNGLTAMQCALQLEKSVNQALLDLHKVASQKGDPHLCDLLESHY 135

  Fly   145 LQEQVDGQKILADYISQLEK---AQNQVGEFLFDKY 177
            |.|||:..|.|.|:|:.|.|   ..|::.|:||||:
Zfish   136 LNEQVEAIKKLGDHITNLSKMDAGNNRMAEYLFDKH 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer3HCHNP_572854.1 Euk_Ferritin 24..177 CDD:153114 69/156 (44%)
Ferritin 25..165 CDD:278632 63/143 (44%)
fthl29NP_001124139.1 Euk_Ferritin 11..171 CDD:153114 69/159 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1528
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H110661
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.