DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXC10 and CG15696

DIOPT Version :10

Sequence 1:NP_059105.2 Gene:HOXC10 / 3226 HGNCID:5122 Length:342 Species:Homo sapiens
Sequence 2:NP_650921.1 Gene:CG15696 / 42469 FlyBaseID:FBgn0038833 Length:179 Species:Drosophila melanogaster


Alignment Length:115 Identity:34/115 - (29%)
Similarity:53/115 - (46%) Gaps:26/115 - (22%)


- Green bases have known domain annotations that are detailed below.


Human   235 AKAADSSPDTSDNEAKEEIKAENTTGNWL------------------TAK--SGRKKRCPYTKHQ 279
            :|.:..||..|..||:..:.      :||                  .||  .||..|.|:|..|
  Fly    47 SKESGGSPPASAAEAQIPVY------DWLQYTRYHPPKLPRALRQNAPAKRTPGRLPRIPFTPQQ 105

Human   280 TLELEKEFLFNMYLTRERRLEISKTINLTDRQVKIWFQNRRMKLKKMNRE 329
            ...||..:..:.||:.|...:::.::.||:.:|||||||||.:.::..||
  Fly   106 LQALENAYKESNYLSAEDANKLADSLELTNTRVKIWFQNRRARERREKRE 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXC10NP_059105.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 187..271 12/55 (22%)
Homeodomain 269..325 CDD:459649 21/55 (38%)
CG15696NP_650921.1 Homeodomain 95..144 CDD:459649 17/48 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.