DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXC10 and CG34031

DIOPT Version :10

Sequence 1:NP_059105.2 Gene:HOXC10 / 3226 HGNCID:5122 Length:342 Species:Homo sapiens
Sequence 2:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster


Alignment Length:195 Identity:40/195 - (20%)
Similarity:65/195 - (33%) Gaps:56/195 - (28%)


- Green bases have known domain annotations that are detailed below.


Human  4512 INVELALRRGLQMKCVFCHKTGATSGCHRFRCTNIYHFTCATKAQCMFFK----DKTM-----LC 4567
            :|.....|..:::...|..|...|   |...|..|.........:|..||    ||.:     .|
  Fly   107 LNANARWRSVMRLATRFSGKKRMT---HAIHCAKIAKEIYLGLRKCNDFKVILDDKDLEYLEAAC 168

Human  4568 PMHK------PKGIHEQQLSYFAVFRRVYVQRDEVRQIASIVQRGERDHTFRVGSLIFHTIGQLL 4626
            .:|.      .||.|:|  ||                  .|::.|:..|::....:  ..|..|:
  Fly   169 FLHNIGIITGKKGYHKQ--SY------------------HIIKNGDHLHSYTAEEI--ELIAMLV 211

Human  4627 PQQMQAFHSPKALFPVGYEASRLYWSTRYANRRCRYLCSIEEKDGRPVFVIRIVEQGHEDLVLSD 4691
            ..|.:.|  ||      .:.:.|...|..|.|:...||.|..        :.:..|.:|::.|.:
  Fly   212 RYQRKKF--PK------LDRAPLKGFTGEAKRKFIILCLITR--------LSVTLQRNENMDLQE 260

Human  4692  4691
              Fly   261  260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXC10NP_059105.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 187..271
Homeodomain 269..325 CDD:459649
CG34031NP_001246894.1 Homeodomain 134..190 CDD:459649 15/75 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.