DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXC10 and unpg

DIOPT Version :9

Sequence 1:NP_059105.2 Gene:HOXC10 / 3226 HGNCID:5122 Length:342 Species:Homo sapiens
Sequence 2:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster


Alignment Length:335 Identity:84/335 - (25%)
Similarity:127/335 - (37%) Gaps:84/335 - (25%)


- Green bases have known domain annotations that are detailed below.


Human    53 LSKRDEGSSPSLALNTYPSY--------------LSQLDSWGDPKAAYRLEQPVGRPLSS----- 98
            ||.|...:|.:|.|..:|.|              |:.|.:.|    .|....|.|.|.:.     
  Fly    66 LSARAMVASSALGLTQFPLYNPWLHGYFAQNHERLTHLIAGG----CYLPSSPAGHPAAQQPQAQ 126

Human    99 ------CSYPPSVKEENVCCMYSAEKRAKSGPEAALYSHPLPESCLGEHEVPVPSYYRASP---- 153
                  ..:||:         ::.||:........|.:..||.:.......|....||...    
  Fly   127 AQPQPPPPHPPT---------HALEKQLPPTLPHPLDTRFLPFNPAAAGVAPTDLSYRRLAELMN 182

Human   154 -----SYSALDKTPHCSGANDFEAPFEQRASLNPRAEHLESPQLGGKVSFPETPKSDSQTP---- 209
                 |.|...:..|.:.|....   |.:|  ||....|:.|......|.|  .||.|.:|    
  Fly   183 QDYVHSLSVHARLQHMAAAGRMH---EDQA--NPGMAQLQEPTPPQAHSSP--AKSGSHSPMEPA 240

Human   210 --------------SPNEIKTEQSLAGPKGSPSESEKER--AKAADSSPDTSDNEAKEE------ 252
                          |.::|....|   |:....|.:|.|  |.....|.|.||:|..:.      
  Fly   241 LDVGMDEDFECSGDSCSDISLTMS---PRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGG 302

Human   253 IKAENTTGNWLTAKS-GRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISKTINLTDRQVKIWF 316
            :..:::.||..::.| .|::|..:|..|.||||:||....||:...|.:|:.::.|::.||||||
  Fly   303 MGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWF 367

Human   317 QNRRMKLKKM 326
            ||||.|.|::
  Fly   368 QNRRAKWKRV 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXC10NP_059105.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 187..271 25/110 (23%)
Homeobox 271..324 CDD:306543 25/52 (48%)
unpgNP_477146.1 Homeobox 324..375 CDD:278475 24/50 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.