DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXC10 and CG11085

DIOPT Version :10

Sequence 1:NP_059105.2 Gene:HOXC10 / 3226 HGNCID:5122 Length:342 Species:Homo sapiens
Sequence 2:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster


Alignment Length:116 Identity:36/116 - (31%)
Similarity:60/116 - (51%) Gaps:15/116 - (12%)


- Green bases have known domain annotations that are detailed below.


Human   221 AGPKGSPSESEKERAKAADSSPDTSDNEAKEEIKAENTTGNWLTAKSGRK---KRCPYTKHQTLE 282
            |...|:..:.:........|...||...|:.:::         .:|||||   :|..:|..|...
  Fly   119 AAASGANGDRDANGGSGPGSGGGTSGGYAEHKLQ---------LSKSGRKPRRRRTAFTHAQLAY 174

Human   283 LEKEFLFNMYLTRERRLEISKTINLTDRQVKIWFQNRRMKLKKMNRENRIR 333
            ||::|....||:...|.::::|:||::.|||.|:||||.|.|   |:|::|
  Fly   175 LERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWK---RQNQLR 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXC10NP_059105.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 187..271 11/52 (21%)
Homeodomain 269..325 CDD:459649 23/58 (40%)
CG11085NP_572815.3 Homeodomain 161..217 CDD:459649 22/58 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.