DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43313 and Saxo1

DIOPT Version :9

Sequence 1:NP_001285184.1 Gene:CG43313 / 32259 FlyBaseID:FBgn0263005 Length:819 Species:Drosophila melanogaster
Sequence 2:XP_006238435.1 Gene:Saxo1 / 679802 RGDID:1583685 Length:476 Species:Rattus norvegicus


Alignment Length:307 Identity:64/307 - (20%)
Similarity:109/307 - (35%) Gaps:59/307 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   329 PEDFYRLHAYYS-----------KHHLEKVQERGYAL-EQKSYRIANGSISNKILEIRWPLGVPP 381
            |..||:..||..           ||....:......| :.:..:..||..:.:.|          
  Rat    84 PVKFYQPAAYVPSQESMNLLTSYKHDFNYIPTCPVGLIKPRDSKFPNGDKTVQYL---------- 138

  Fly   382 PSAPETRHDILTW-----QLLNGTHNFLP-----NGNAEH-------AVATLSRIEAQDFAKVLE 429
               |..:.|.:.|     :||...|.:.|     .....|       .:.|....:....||:..
  Rat   139 ---PTYKVDYVPWNQPRRELLRPPHKYRPESAKFENRTTHQDDYTMKCLVTTESCKPSVKAKICN 200

  Fly   430 IALQYAALKHPRLSY--HSLHSAYRKFDATRGMDYQLHL-NLQEGSGRSRRLVIKSFEVVKPLGR 491
            |.|:  .|.:.::||  |.:...:.| :|.:.:...:.. ||.......|.|:.:..:..||.|:
  Rat   201 IPLE--DLTNYKMSYVPHPVEKRFVK-EAEKYIPCDIPFENLTTHKESYRGLLGEPAKSSKPPGK 262

  Fly   492 VEV--VPSPYVTESTRIAMLVPAFEHQVPDA-LLFVEQYERICMQNQDNTFLLLIFMYRLESPSK 553
            :.|  ||...:||........|. ...||.| :::|...|::.:.....|.    :.:|..||:.
  Rat   263 IPVHDVPFSDITEIQEKYQAWPT-PQIVPKAPVVYVPPEEKMDLLTTVQTH----YKHRKGSPAI 322

  Fly   554 GDEDPFKALKTLALDLSSKYKTDGSRIAWVS---IRLPEQLSEPVDP 597
            .........|:.....|:..|.|..:.|.|:   ||....|:.||:|
  Rat   323 TCRPVPSIKKSGRFQSSTTSKDDFKQWAAVNTKPIRPVPHLNLPVEP 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43313NP_001285184.1 CHGN 254..804 CDD:283361 64/307 (21%)
Saxo1XP_006238435.1 STOP 5..218 CDD:283000 28/148 (19%)
STOP <298..430 CDD:283000 17/76 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3708
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.