DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43313 and saxo2

DIOPT Version :9

Sequence 1:NP_001285184.1 Gene:CG43313 / 32259 FlyBaseID:FBgn0263005 Length:819 Species:Drosophila melanogaster
Sequence 2:NP_001032667.1 Gene:saxo2 / 641580 ZFINID:ZDB-GENE-051127-27 Length:463 Species:Danio rerio


Alignment Length:380 Identity:78/380 - (20%)
Similarity:124/380 - (32%) Gaps:96/380 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 EPHLNLINKPLAAKKPVKNVIRPRYYSSELGIREKLFIGVMTSQEHINTF-ATAFNRT------T 112
            :|..|::::......|.|...||:....:|..:           .|.:|. ||...||      .
Zfish    28 DPQTNVLSEYTEKYPPYKGHTRPKSLKPQLKYK-----------AHQDTMDATTTFRTDYIPYPV 81

  Fly   113 AHLVNKIKFFIYADS----VKTNYKLK----NIVGFTDTRESRRPFHVVKYIAD---NYLDEYDY 166
            .|...|.:......|    :.|.||..    .:..||..|...| .|||....|   .|.:::..
Zfish    82 THRPEKQQLEYKPKSGEIDLGTTYKQDFNPYEVQPFTPLRPKER-VHVVNAKLDTVPTYKEDFRQ 145

  Fly   167 FLLV------PDTVY-VDARKLVKLLYHMSITF--DLYMGG--ARIGLDPSGGGASADGQSNEPP 220
            :.::      |||.| ..|.|     :..|.||  |....|  .|....||.....:|....:..
Zfish   146 WEIIRRELTKPDTTYQPPATK-----FGNSTTFQDDFVHRGLVPRESYKPSNVAKLSDTPFEKNT 205

  Fly   221 ANE-EEAPGASDRNYCSLEAGILLSSSVIRKMRNNLERCVRIGSTSDHSVNIGRC----VKYASR 280
            :|: ...|...:..|.........||.....:..:.:....:.|.|..|     |    ||.|| 
Zfish   206 SNKLSYVPHPLEARYVKPPEEYKPSSHPFHDVTTHRQDYQGLPSQSTKS-----CKPEPVKVAS- 264

  Fly   281 VAGCQESFQGMRQF-----SYALDAPGRRHREFSELAKEEAFRNASTVYPVQTPEDFYRLHAYYS 340
                .:.||...:|     .:.:..|        ::.|...:.:.:....:.|..     |:.|.
Zfish   265 ----NKPFQSSTEFRDQYQHWPVSLP--------QMQKSVEYTSPTANMDLTTTS-----HSDYI 312

  Fly   341 KHHLEK-VQERGYALEQKSYRIANG----------------SISNKILEIRWPLG 378
            ||.::. |..:.::|..||.|...|                ||..|..|::.|.|
Zfish   313 KHQIQPFVSSKPFSLPAKSSRPFQGNTTMRDDFQPWVAQRQSIIRKQAELQRPSG 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43313NP_001285184.1 CHGN 254..804 CDD:283361 30/151 (20%)
saxo2NP_001032667.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3708
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.