DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2200 and dpepe

DIOPT Version :9

Sequence 1:NP_001285183.1 Gene:CG2200 / 32258 FlyBaseID:FBgn0030447 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001016448.1 Gene:dpepe / 549202 XenbaseID:XB-GENE-480544 Length:240 Species:Xenopus tropicalis


Alignment Length:242 Identity:126/242 - (52%)
Similarity:164/242 - (67%) Gaps:8/242 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASARNLLLLSSSRLHGHGYLEHARGQLEDLFKSANVKTVLFVPYALRDHDKYTATVRDALQPWG 65
            |...|:|||:|:|.|||.|||||.:..:.. |....||.|||:||||.|.|.|..|.|...:..|
 Frog     2 MPIRRHLLLISNSTLHGGGYLEHCQEHILK-FLGTQVKRVLFIPYALHDRDSYAKTARQKFEALG 65

  Fly    66 FNVEGLHTKPDREQALREAQAIFVGGGNTFVLLRSLYEMKLLDPIRELVLQRGLPYVGSSAGTNV 130
            :.::.:|..||...|:::|:|||:||||||.||::||:..|:..||:.||:.|:||:||||||||
 Frog    66 YGLDSVHESPDPVDAVKKAEAIFIGGGNTFRLLKALYDSDLIAAIRKRVLEDGVPYIGSSAGTNV 130

  Fly   131 ATRSIHTTNDMPVAYPPSFEALALVPFNINPHYLDPEAGSRHKGETRDERLEEFVAYH----GLP 191
            ||.||:||||||:.||||.:||.||||||||||||.:..|:|.||||::|:.:   ||    ..|
 Frog   131 ATVSINTTNDMPIVYPPSLQALHLVPFNINPHYLDSDVNSKHMGETREQRITQ---YHEELDTPP 192

  Fly   192 VLGLREGTSVRVQGEKAILLGDRNAKLFKADGGTEELAPLADLTFLL 238
            |||||||..:.|:|:||.|||...|:||.......|..|..|.:|||
 Frog   193 VLGLREGCLLLVEGDKATLLGITKARLFVRGKSPSEHEPGHDFSFLL 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2200NP_001285183.1 GAT_1 16..238 CDD:294025 116/225 (52%)
dpepeNP_001016448.1 PRK05282 8..239 CDD:179990 122/234 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 225 1.000 Domainoid score I2480
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H15727
Inparanoid 1 1.050 242 1.000 Inparanoid score I3241
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1341849at2759
OrthoFinder 1 1.000 - - FOG0010913
OrthoInspector 1 1.000 - - oto105399
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R17281
SonicParanoid 1 1.000 - - X8455
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.