DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2200 and AgaP_AGAP000513

DIOPT Version :9

Sequence 1:NP_001285183.1 Gene:CG2200 / 32258 FlyBaseID:FBgn0030447 Length:240 Species:Drosophila melanogaster
Sequence 2:XP_003437017.1 Gene:AgaP_AGAP000513 / 1271729 VectorBaseID:AGAP000513 Length:247 Species:Anopheles gambiae


Alignment Length:246 Identity:138/246 - (56%)
Similarity:173/246 - (70%) Gaps:12/246 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RNLLLLSSSRLHGHGYLEHARGQLEDLFKSANVKTVLFVPYALRDHDKYTATVRDALQPWGFNVE 69
            |.|||:|||.:||.||||||...|....|..:|:.||||||||.|||.||..|...|:..||...
Mosquito     4 RQLLLMSSSAVHGFGYLEHAESDLTSFLKHNSVQEVLFVPYALTDHDGYTERVGSVLRKLGFGCT 68

  Fly    70 GLHTKPDREQALREAQAIFVGGGNTFVLLRSLYEMKLLDPIRELVLQRGLPYVGSSAGTNVATRS 134
            |:||.||..:|::.||||::||||||:||.:||..:|:.||||.|||.|:||||||||||||||:
Mosquito    69 GIHTAPDPVRAVQTAQAIYIGGGNTFLLLDTLYRRQLVGPIRERVLQHGVPYVGSSAGTNVATRT 133

  Fly   135 IHTTNDMPVAYPPSFEALALVPFNINPHYLDPEAGSRHKGETRDERLEEFVAYHGLPVLGLREGT 199
            |.||||||:..|.||||||||||||||||||||....||||||.||:.:|...:..|||||.|||
Mosquito   134 IQTTNDMPIVQPASFEALALVPFNINPHYLDPEPNGTHKGETRPERINQFHELNEAPVLGLAEGT 198

  Fly   200 SVRVQGEKAILLGDR--------NAKLFKADGGTEELAPL--ADLTFLLQK 240
            ::.|.|::|.|:|.:        :|:||:.  |.|.:...  :||:|||::
Mosquito   199 ALFVDGDRATLVGPQPAVPGTPYDARLFRK--GEESVLYKVGSDLSFLLRE 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2200NP_001285183.1 GAT_1 16..238 CDD:294025 129/231 (56%)
AgaP_AGAP000513XP_003437017.1 PRK05282 6..245 CDD:179990 135/240 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 255 1.000 Domainoid score I4706
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H15727
Inparanoid 1 1.050 263 1.000 Inparanoid score I5476
OMA 1 1.010 - - QHG63456
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0010913
OrthoInspector 1 1.000 - - oto111259
Panther 1 1.100 - - LDO PTHR20842
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X8455
TreeFam 00.000 Not matched by this tool.
1010.070

Return to query results.
Submit another query.