DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2200 and kif5c

DIOPT Version :9

Sequence 1:NP_001285183.1 Gene:CG2200 / 32258 FlyBaseID:FBgn0030447 Length:240 Species:Drosophila melanogaster
Sequence 2:XP_002935337.3 Gene:kif5c / 100493873 XenbaseID:XB-GENE-977474 Length:959 Species:Xenopus tropicalis


Alignment Length:132 Identity:27/132 - (20%)
Similarity:42/132 - (31%) Gaps:47/132 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASARNLLLLSSSRLHGHGYLEHARGQLEDLFKSANVKTVLFVPYALRDHDKYTATVRDALQPWG 65
            |.|.|.......|||...  :|..:..::|| |..|.|..|.:.....|::|             
 Frog   707 MESHREAHQKQLSRLRDE--IEEKQKMIDDL-KDLNQKLQLQLDKLTSDYEK------------- 755

  Fly    66 FNVEGLHTKPDREQALREAQAIFVGGGNTFVLLRS----------------LYEMKLLDPIRELV 114
                   .|.:.||...:.|.:        |||..                ..|::.|..:|:|.
 Frog   756 -------LKTEEEQREEDLQKL--------VLLNEKREQSREDLKGLEETVARELQTLHNLRKLF 805

  Fly   115 LQ 116
            :|
 Frog   806 IQ 807

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2200NP_001285183.1 GAT_1 16..238 CDD:294025 21/117 (18%)
kif5cXP_002935337.3 KISc_KHC_KIF5 6..327 CDD:276820
COG4372 469..>673 CDD:226809
SMC_prok_B 580..>912 CDD:274008 27/132 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165174501
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.