DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2200 and vps35l

DIOPT Version :9

Sequence 1:NP_001285183.1 Gene:CG2200 / 32258 FlyBaseID:FBgn0030447 Length:240 Species:Drosophila melanogaster
Sequence 2:XP_012826281.1 Gene:vps35l / 100145160 XenbaseID:XB-GENE-5857341 Length:963 Species:Xenopus tropicalis


Alignment Length:184 Identity:36/184 - (19%)
Similarity:56/184 - (30%) Gaps:80/184 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 GNTFVLLRSLYEMKLLDPIRELVLQRGLPYVG----------------SSAGTNVATRSIHTTND 140
            ||..:||.|:......|    .:..|.:.::|                .|.|.|:|         
 Frog   422 GNNALLLNSVMSAFRAD----FIATRSMDFIGMIKECDEAGFPKHLLFRSLGLNLA--------- 473

  Fly   141 MPVAYPPSFEALALV--PFNI-----NPH-YLD-----PEAGSRH--------------KGETRD 178
              :|.||..:.|.::  .:.:     ||. |::     .|...||              |..|.|
 Frog   474 --LADPPENDRLQILNEAWKVITKLRNPQDYINCSEVWVEYTCRHFTKREVNTILADIIKHMTPD 536

  Fly   179 ERLEE----------------------FVAYHGLPVLGLREGTSVRVQGEKAIL 210
            ...|:                      |.....||.|.:.:..||||:..|.|:
 Frog   537 RAFEDAYQQLQSVITKVITHFQDFSVLFSVEKFLPFLDMFQKESVRVEVCKCIM 590

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2200NP_001285183.1 GAT_1 16..238 CDD:294025 36/184 (20%)
vps35lXP_012826281.1 Vps35 <522..>737 CDD:367586 14/69 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 225 1.000 Domainoid score I2480
eggNOG 1 0.900 - - E1_COG3340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 242 1.000 Inparanoid score I3241
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0010913
OrthoInspector 1 1.000 - - oto105399
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R17281
SonicParanoid 1 1.000 - - X8455
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.940

Return to query results.
Submit another query.