DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lic and MKK2

DIOPT Version :9

Sequence 1:NP_477162.1 Gene:lic / 32257 FlyBaseID:FBgn0261524 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_015185.1 Gene:MKK2 / 855963 SGDID:S000006061 Length:506 Species:Saccharomyces cerevisiae


Alignment Length:294 Identity:114/294 - (38%)
Similarity:166/294 - (56%) Gaps:22/294 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 DSLEKICDLGRGAYGIVDKMRHKQTDTVLAVKRI-PMTVNIREQHRLVMDLDISMRSSDCPYTVH 107
            |.:..:..||.||.|.|.|.|.|....|.|:|.| .|..:...|.::..:|..: :|....|.|.
Yeast   212 DEITTLGILGEGAGGSVAKCRLKNGKKVFALKTINTMNTDPEYQKQIFRELQFN-KSFKSDYIVQ 275

  Fly   108 FYGAMYRE--GDVWICMEVM-STSLDKFYPKVFLHDLRMEESVLGKIAMSVVSALHYLHAQLKVI 169
            :||....|  ..::|.||.| ..||:..|..:.....|:.|.|:||||.||:..|.||| :.|||
Yeast   276 YYGMFTDEQSSSIYIAMEYMGGKSLEATYKNLLKRGGRISERVIGKIAESVLRGLSYLH-ERKVI 339

  Fly   170 HRDVKPSNILINRAGQVKICDFGISGYLVDSIAKTIDAGCKPYMAPERIDPQGNPAQYDIRSDVW 234
            |||:||.|||:|..|::|:||||:||..|:|:|.|. .|...|||||||  ||.|  |.:..|||
Yeast   340 HRDIKPQNILLNEKGEIKLCDFGVSGEAVNSLAMTF-TGTSFYMAPERI--QGQP--YSVTCDVW 399

  Fly   235 SLGIGMIEMATGRYPYDNWR-----TPFEQLRQVVEDSP-----PRLPEGTFSPEFEDFIAVCLQ 289
            |||:.::|:|.||:|:::.:     .|.|.|..::..||     |.| :.::|..|..||..||:
Yeast   400 SLGLTLLEVAGGRFPFESDKITQNVAPIELLTMILTFSPQLKDEPEL-DISWSKTFRSFIDYCLK 463

  Fly   290 KEYMARPNYEQLLKHSFIVEHLQRNTDISEFVAR 323
            |:...||:..|:|||.:||..:::..::..||.:
Yeast   464 KDARERPSPRQMLKHPWIVGQMKKKVNMERFVKK 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
licNP_477162.1 PKc_MKK3_6 44..326 CDD:173729 114/294 (39%)
MKK2NP_015185.1 PKc_Pek1_like 212..499 CDD:270793 114/294 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343442
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48013
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.