DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lic and STE7

DIOPT Version :9

Sequence 1:NP_477162.1 Gene:lic / 32257 FlyBaseID:FBgn0261524 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_010122.1 Gene:STE7 / 851396 SGDID:S000002318 Length:515 Species:Saccharomyces cerevisiae


Alignment Length:335 Identity:112/335 - (33%)
Similarity:167/335 - (49%) Gaps:44/335 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TIAKEPEAAIVPPRNLDSRATIQIGDRTFDIDADSLEKICDLGRGAYGIVDKMRHKQTDTVLAVK 75
            :|:..|....:.|...|.:.|:........|....|.::..:|.|..|.|.|..|.....::|.|
Yeast   156 SISLPPLEESLSPAAADLKDTLSGTSNGNYIQLQDLVQLGKIGAGNSGTVVKALHVPDSKIVAKK 220

  Fly    76 RIPMTVNIREQ------HRLVMDLDISMRSSDCPYTVHFYGAMYRE---GDVWICMEVMST-SLD 130
            .||:     ||      ::||.:|.|..........:.||||.|.:   .::.|.||.... |||
Yeast   221 TIPV-----EQNNSTIINQLVRELSIVKNVKPHENIITFYGAYYNQHINNEIIILMEYSDCGSLD 280

  Fly   131 KFY--------------PKVFLHDLRMEESVLGKIAMSVVSALHYLHAQLKVIHRDVKPSNILIN 181
            |..              .|.:.::|     .:.|||..|::.|.:|:.|.|:||||:||||:|||
Yeast   281 KILSVYKRFVQRGTVSSKKTWFNEL-----TISKIAYGVLNGLDHLYRQYKIIHRDIKPSNVLIN 340

  Fly   182 RAGQVKICDFGISGYLVDSIAKTIDAGCKPYMAPERIDPQGNPAQYDIRSDVWSLGIGMIEMATG 246
            ..||:|:||||:|..|::|||.|. .|...||:||||  |||  .|.|:.||||||:.:||:.||
Yeast   341 SKGQIKLCDFGVSKKLINSIADTF-VGTSTYMSPERI--QGN--VYSIKGDVWSLGLMIIELVTG 400

  Fly   247 RYPYDNWR-TP---FEQLRQVVEDSPPRLP-EGTFSPEFEDFIAVCLQKEYMARPNYEQLLKHSF 306
            .:|..... ||   .:.|:::|.:..|||| :..:|.|..||:..|..|....|.:..:||.|..
Yeast   401 EFPLGGHNDTPDGILDLLQRIVNEPSPRLPKDRIYSKEMTDFVNRCCIKNERERSSIHELLHHDL 465

  Fly   307 IVEHLQRNTD 316
            |::::..:.|
Yeast   466 IMKYVSPSKD 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
licNP_477162.1 PKc_MKK3_6 44..326 CDD:173729 106/302 (35%)
STE7NP_010122.1 PKc_Byr1_like 185..482 CDD:270792 107/306 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48013
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2221
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.