DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lic and MKK9

DIOPT Version :9

Sequence 1:NP_477162.1 Gene:lic / 32257 FlyBaseID:FBgn0261524 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_177492.1 Gene:MKK9 / 843685 AraportID:AT1G73500 Length:310 Species:Arabidopsis thaliana


Alignment Length:321 Identity:111/321 - (34%)
Similarity:159/321 - (49%) Gaps:51/321 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RNLDSRATI-QIGDRTFD----------------IDADSLEKICDLGRGAYGIVDKMRHKQTDTV 71
            |.|:.|..: .|.||.|.                |.|..|||:..||.|..|||.|:|||.|..:
plant     8 RQLNLRLPLPPISDRRFSTSSSSATTTTVAGCNGISACDLEKLNVLGCGNGGIVYKVRHKTTSEI 72

  Fly    72 LAVKRIPMTVNIREQHRLVMDLDISMRSSDCPYTVHFYGAMYRE--GDVWICMEVMSTSLDKFYP 134
            .|:|.:...::.....:|:.:::| :|.:|.||.|..:|...:.  |:|.|.||.|....     
plant    73 YALKTVNGDMDPIFTRQLMREMEI-LRRTDSPYVVKCHGIFEKPVVGEVSILMEYMDGGT----- 131

  Fly   135 KVFLHDLR--MEESVLGKIAMSVVSALHYLHAQLKVIHRDVKPSNILINRAGQVKICDFGISGYL 197
               |..||  :.|..|...|..::..|.|||| ||::|||:||:|:|:|...:|||.|||:|..|
plant   132 ---LESLRGGVTEQKLAGFAKQILKGLSYLHA-LKIVHRDIKPANLLLNSKNEVKIADFGVSKIL 192

  Fly   198 VDSIAKTIDA-----GCKPYMAPERIDPQGNPAQYDI-RSDVWSLGIGMIEMATGRYPY------ 250
            |    :::|:     |...||:|||.|.:.:....|| ..|:||.|:.|:|:..|.:|.      
plant   193 V----RSLDSCNSYVGTCAYMSPERFDSESSGGSSDIYAGDIWSFGLMMLELLVGHFPLLPPGQR 253

  Fly   251 DNWRTPFEQLRQVVEDSPPRLPEGTFSPEFEDFIAVCLQKEYMARPNYEQLLKHSFIVEHL 311
            .:|.|   .:..|....|||.|||. |.||..|:..||:|:...|....|||.|.|:.|.|
plant   254 PDWAT---LMCAVCFGEPPRAPEGC-SEEFRSFVECCLRKDSSKRWTAPQLLAHPFLREDL 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
licNP_477162.1 PKc_MKK3_6 44..326 CDD:173729 102/284 (36%)
MKK9NP_177492.1 PKc_MAPKK_plant_like 46..308 CDD:132954 100/279 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D688282at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.