DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lic and MKK7

DIOPT Version :9

Sequence 1:NP_477162.1 Gene:lic / 32257 FlyBaseID:FBgn0261524 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_173271.1 Gene:MKK7 / 838416 AraportID:AT1G18350 Length:307 Species:Arabidopsis thaliana


Alignment Length:286 Identity:98/286 - (34%)
Similarity:143/286 - (50%) Gaps:33/286 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 IDADSLEKICDLGRGAYGIVDKMRHKQTDTVLAVKRIPMTVNIREQHRLVMDLDISMRSSDCPYT 105
            |.|..:||:..||||:.|||.|:.||.|..:.|:|.:...::.....:|..:::| :|.:|.||.
plant    40 ISASDVEKLHVLGRGSSGIVYKVHHKTTGEIYALKSVNGDMSPAFTRQLAREMEI-LRRTDSPYV 103

  Fly   106 VHFYGAMYRE--GDVWICMEVMSTSLDKFYPKVFLHDLR--MEESVLGKIAMSVVSALHYLHAQL 166
            |...|...:.  |:|.|.||.|...        .|..||  :.|..|...:..::..|.|||: |
plant   104 VRCQGIFEKPIVGEVSILMEYMDGG--------NLESLRGAVTEKQLAGFSRQILKGLSYLHS-L 159

  Fly   167 KVIHRDVKPSNILINRAGQVKICDFGISGYLVDSIAKTID-----AGCKPYMAPERIDPQGNPAQ 226
            |::|||:||:|:|:|...:|||.|||:|    ..|.:::|     .|...||:|||.|.......
plant   160 KIVHRDIKPANLLLNSRNEVKIADFGVS----KIITRSLDYCNSYVGTCAYMSPERFDSAAGENS 220

  Fly   227 YDIRSDVWSLGIGMIEMATGRYPY------DNWRTPFEQLRQVVEDSPPRLPEGTFSPEFEDFIA 285
            .....|:||.|:.::|:..|.:|.      .:|.|   .:..|....|||.|||. |.||..|:.
plant   221 DVYAGDIWSFGVMILELFVGHFPLLPQGQRPDWAT---LMCVVCFGEPPRAPEGC-SDEFRSFVD 281

  Fly   286 VCLQKEYMARPNYEQLLKHSFIVEHL 311
            .||:||...|....|||.|.|:.|.|
plant   282 CCLRKESSERWTASQLLGHPFLRESL 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
licNP_477162.1 PKc_MKK3_6 44..326 CDD:173729 96/283 (34%)
MKK7NP_173271.1 PKc_MAPKK_plant_like 43..305 CDD:132954 94/279 (34%)
S_TKc 46..303 CDD:214567 93/274 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D688282at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.