DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lic and MKK8

DIOPT Version :9

Sequence 1:NP_477162.1 Gene:lic / 32257 FlyBaseID:FBgn0261524 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_187274.1 Gene:MKK8 / 819797 AraportID:AT3G06230 Length:293 Species:Arabidopsis thaliana


Alignment Length:290 Identity:85/290 - (29%)
Similarity:142/290 - (48%) Gaps:40/290 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 IVPPRNLDSRATI-QIGDRTFDIDADSLEKICDLGRGAYGIVDKMRHKQTDTVLAVKRIPM---T 80
            |:|...:.  ||: .....||.:  .:|::|..||.|..|.|.|::.|.|..:.|:|::..   :
plant    30 IIPATKVS--ATVSSCASNTFSV--ANLDRISVLGSGNGGTVFKVKDKTTSEIYALKKVKENWDS 90

  Fly    81 VNIREQHRLVMDLDISMRSSDCPYTVHFYGAMYR-EGDVWICMEVMSTSLDKFYPKVFLHDLR-M 143
            .::||       ::| :|..:.||....:..... .|:|.|.|:.|...        .|..|| :
plant    91 TSLRE-------IEI-LRMVNSPYVAKCHDIFQNPSGEVSILMDYMDLG--------SLESLRGV 139

  Fly   144 EESVLGKIAMSVVSALHYLHAQLKVIHRDVKPSNILINRAGQVKICDFGISGYLVDSIAKTID-A 207
            .|..|..::..|:...:||| :.|::|||:||:|:|.:...:|||.|||:|..:|.|:.|... .
plant   140 TEKQLALMSRQVLEGKNYLH-EHKIVHRDIKPANLLRSSKEEVKIADFGVSKIVVRSLNKCNSFV 203

  Fly   208 GCKPYMAPERIDPQGNPAQYDIRS-----DVWSLGIGMIEMATGRYPYDNWRTPFEQ--LRQVVE 265
            |...||:|||:|.:.:....:.:|     |:||.|:.|:|:..|.||    ..|.:.  :..|..
plant   204 GTFAYMSPERLDSEADGVTEEDKSNVYAGDIWSFGLTMLEILVGYYP----MLPDQAAIVCAVCF 264

  Fly   266 DSPPRLPEGTFSPEFEDFIAVCLQKEYMAR 295
            ..||:.|| ..|.:.:.|:..||:|:...|
plant   265 GEPPKAPE-ECSDDLKSFMDCCLRKKASER 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
licNP_477162.1 PKc_MKK3_6 44..326 CDD:173729 79/265 (30%)
MKK8NP_187274.1 PKc_like 51..293 CDD:304357 78/263 (30%)
S_TKc 56..293 CDD:214567 77/258 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D688282at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.