DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lic and map2k2a

DIOPT Version :9

Sequence 1:NP_477162.1 Gene:lic / 32257 FlyBaseID:FBgn0261524 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001032468.2 Gene:map2k2a / 563181 ZFINID:ZDB-GENE-041027-1 Length:397 Species:Danio rerio


Alignment Length:377 Identity:122/377 - (32%)
Similarity:193/377 - (51%) Gaps:79/377 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KRHRLTPFTIAKEPEAAIVPPRNLDSRATIQIGDRTFDIDADSLEKICDLGRGAYGIVDKMRHKQ 67
            :|.||..|...|                 .|:|    ::..:..|.||:||.|..|:|.|:|||.
Zfish    47 QRKRLEAFLTQK-----------------AQVG----ELKDEDFEPICELGAGNGGVVHKVRHKP 90

  Fly    68 TDTVLAVKRIPMTVNIREQHRLVMDLDISMRSSDCPYTVHFYGAMYREGDVWICMEVM-STSLDK 131
            :..|:|.|.|.:.:....:::::.:|.: :...:.||.|.||||.|.:|::.||||.| ..||| 
Zfish    91 SRLVMARKLIHLEIKPAIRNQIIRELQV-LHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLD- 153

  Fly   132 FYPKVFLHDLRMEESVLGKIAMSVVSALHYLHAQLKVIHRDVKPSNILINRAGQVKICDFGISGY 196
               :|.....|:.|.:|||::::|:..|.||..:.:::||||||||||:|..|::|:||||:||.
Zfish   154 ---QVLKEARRIPEEILGKVSIAVLRGLAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQ 215

  Fly   197 LVDSIAKTIDAGCKPYMAPERIDPQGNPAQYDIRSDVWSLGIGMIEMATGRYPY----------- 250
            |:||:|.:. .|.:.||:|||:  ||  ..|.::|||||:|:.::|:|.||||.           
Zfish   216 LIDSMANSF-VGTRSYMSPERL--QG--THYSVQSDVWSMGLSLVELAIGRYPIPPPDAKELEAI 275

  Fly   251 -----------------DNWRTP-----------------FEQLRQVVEDSPPRLPEGTFSPEFE 281
                             ...|.|                 ||.|..:|.:.||:||.|.|:.:||
Zfish   276 FGRPVLDAGGAEGHSMSPRPRPPGRPVSGHGMDSRPAMAIFELLDYIVNEPPPKLPHGVFTTDFE 340

  Fly   282 DFIAVCLQKEYMARPNYEQLLKHSFIVEHLQRNTDISEFVARILDLPDAQPA 333
            :|:..||.|....|.:.:.|:.|:||........|.:.::.:.:.|  .||:
Zfish   341 EFVTKCLIKNPADRADLKMLMGHTFIKRAEVEEVDFAGWLCKTMGL--HQPS 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
licNP_477162.1 PKc_MKK3_6 44..326 CDD:173729 112/327 (34%)
map2k2aNP_001032468.2 PKc_MEK2 63..393 CDD:132980 115/340 (34%)
S_TKc 69..366 CDD:214567 109/306 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D688282at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2221
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.