DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lic and map3k3

DIOPT Version :9

Sequence 1:NP_477162.1 Gene:lic / 32257 FlyBaseID:FBgn0261524 Length:334 Species:Drosophila melanogaster
Sequence 2:XP_688694.2 Gene:map3k3 / 560211 ZFINID:ZDB-GENE-070910-1 Length:620 Species:Danio rerio


Alignment Length:270 Identity:81/270 - (30%)
Similarity:127/270 - (47%) Gaps:31/270 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 LGRGAYGIVDKMRHKQTDTVLAVKRIPMTVNIREQHRLVMDLDIS---MRSSDCPYTVHFYGAM- 112
            ||:||:|.|.......|...||.|::.......|..:.|..|:..   :::......|.:||.: 
Zfish   362 LGQGAFGRVYLCYDVDTGRELAAKQVHFDPASPETSKEVSALECEIQLLKNLHHERIVQYYGCLR 426

  Fly   113 -YREGDVWICMEVMSTSLDKFYPKVFLHDLRMEESVLGKIAMSVVSALHYLHAQLKVIHRDVKPS 176
             :.|..:.|.||.|.....|...|.:   ..:.|:|..|....::..:.|||:.: ::|||:|.:
Zfish   427 DHNEKTLTIFMEYMPGGSVKDQLKAY---GALTENVTRKYTRQILEGMSYLHSNM-IVHRDIKGA 487

  Fly   177 NILINRAGQVKICDFGISGYL---------VDSIAKTIDAGCKPY-MAPERIDPQGNPAQYDIRS 231
            |||.:.||.||:.|||.|..|         |.|:..|      || |:||.|..:|    |..::
Zfish   488 NILRDSAGNVKLGDFGASKRLQTICMSSTGVRSVTGT------PYWMSPEVISGEG----YGRKA 542

  Fly   232 DVWSLGIGMIEMATGRYPYDNWRTPFEQLRQVVEDSPPRLPEGTFSPEFEDFIAVCLQKEYMARP 296
            ||||||..::||.|.:.|:..:.......:...:.:.|:|| ...|....||:. |:..|...||
Zfish   543 DVWSLGCTVVEMLTEKPPWAEFEAMAAIFKIATQPTNPQLP-SHISEHTRDFLR-CIFVEAKYRP 605

  Fly   297 NYEQLLKHSF 306
            :.|:||:|.|
Zfish   606 SAEELLRHPF 615

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
licNP_477162.1 PKc_MKK3_6 44..326 CDD:173729 81/270 (30%)
map3k3XP_688694.2 PB1_Mekk2_3 48..126 CDD:99726
STKc_MEKK3_like 356..615 CDD:270795 80/268 (30%)
S_TKc 356..615 CDD:214567 80/268 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579515
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.