DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lic and nek1

DIOPT Version :9

Sequence 1:NP_477162.1 Gene:lic / 32257 FlyBaseID:FBgn0261524 Length:334 Species:Drosophila melanogaster
Sequence 2:XP_009292952.1 Gene:nek1 / 556002 ZFINID:ZDB-GENE-040730-1 Length:1413 Species:Danio rerio


Alignment Length:291 Identity:64/291 - (21%)
Similarity:127/291 - (43%) Gaps:49/291 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 DSLEKICDLGRGAYGI-------------------VDKMRHKQTDTVLAVKRIPMTVNIREQHRL 89
            |..|::..:|.|::|.                   :.:|.:|:...  :.|.:.:..|:  .|..
Zfish     2 DKYERLKKIGEGSFGKAILVKSRTDGRQYVIKEIGISRMSNKERQE--SRKEVAVLANM--SHPN 62

  Fly    90 VMDLDISMRSSDCPYTVHFYGAMYREGDVWICMEVMSTSLDKFYPKVFLHDLRMEESVLGKIAMS 154
            ::....|...|.|.|.|..|   ...||::   :.::......:|         ||.:|... :.
Zfish    63 IVQYKESFEESGCLYIVMDY---CEGGDLF---KKINNQRGSLFP---------EEQILDWF-VQ 111

  Fly   155 VVSALHYLHAQLKVIHRDVKPSNILINRAGQVKICDFGISGYLVDSI--AKTIDAGCKPYMAPER 217
            :..||.::|.: |::|||:|..||.:.:.|.|::.||||:..|..::  |:|. .|...|::||.
Zfish   112 ICLALKHVHDR-KILHRDIKSQNIFLTKDGTVQLGDFGIARVLNSTVELARTC-IGTPYYLSPEI 174

  Fly   218 IDPQGNPAQYDIRSDVWSLGIGMIEMATGRYPYDNWRTPFEQLRQVVEDSPPRLPEGTFSPEFED 282
            .:.:    .|:.:||:|:||..:.||.|.::.::........|:.:....||  ....:||:...
Zfish   175 CENK----PYNNKSDIWALGCVLYEMCTLKHAFEAGNMKNLVLKIIRGSYPP--VSIHYSPDLRS 233

  Fly   283 FIAVCLQKEYMARPNYEQLLKHSFIVEHLQR 313
            .:|...::....||:...:|...|:...:.:
Zfish   234 LLAQLFKRNPRERPSVSTILDKPFLARRIHK 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
licNP_477162.1 PKc_MKK3_6 44..326 CDD:173729 64/291 (22%)
nek1XP_009292952.1 STKc_Nek1 3..258 CDD:270858 62/282 (22%)
S_TKc 4..258 CDD:214567 62/281 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579513
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.