DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lic and map2k5

DIOPT Version :9

Sequence 1:NP_477162.1 Gene:lic / 32257 FlyBaseID:FBgn0261524 Length:334 Species:Drosophila melanogaster
Sequence 2:XP_017947570.1 Gene:map2k5 / 549042 XenbaseID:XB-GENE-960353 Length:474 Species:Xenopus tropicalis


Alignment Length:311 Identity:124/311 - (39%)
Similarity:175/311 - (56%) Gaps:33/311 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 IQIGDRTFDIDADSLEKICDLGRGAYGIVDKMRHKQTDTVLAVKRIPMTVNIREQHRLVMDLDIS 96
            :.||..:.|:|.....:          |:.|..|..:..:||||.||:.:.:..|.:::.:|:| 
 Frog   188 MSIGRTSEDLDKGPCRR----------IMGKAYHVPSGKILAVKVIPLDITVELQRQIMSELEI- 241

  Fly    97 MRSSDCPYTVHFYGAMYREGDVWICMEVM-STSLDKFYPKVFLHDLRMEESVLGKIAMSVVSALH 160
            :...|..|.:.||||.:.|..:.||.|.| ..||| .|.|:       .|.|||:||::|:..|.
 Frog   242 LYKCDSLYIIGFYGAFFVENRISICTEFMDGGSLD-VYRKI-------PEQVLGRIAVAVLKGLT 298

  Fly   161 YLHAQLKVIHRDVKPSNILINRAGQVKICDFGISGYLVDSIAKTIDAGCKPYMAPERIDPQGNPA 225
            ||.: ||::||||||||:|:|..|.||:||||:|..||:|||||. .|...|||||||..:    
 Frog   299 YLWS-LKILHRDVKPSNMLVNTRGHVKLCDFGVSTQLVNSIAKTY-VGTNAYMAPERIAGE---- 357

  Fly   226 QYDIRSDVWSLGIGMIEMATGRYPYDNWR------TPFEQLRQVVEDSPPRLPEGTFSPEFEDFI 284
            ||.|.||||||||..:|:|.||:||...:      .|.:.|:.:|::..|.||.|.||..|..||
 Frog   358 QYGIHSDVWSLGISFMELALGRFPYPQIQKNHGSLMPLQILQCIVDEECPVLPLGEFSESFVHFI 422

  Fly   285 AVCLQKEYMARPNYEQLLKHSFIVEHLQRNTD-ISEFVARILDLPDAQPAQ 334
            ..|::|....||..|:|:.|.|||:....||: :|.:|.|.|:....|..|
 Frog   423 TQCMRKPPKERPAPEELMDHPFIVQFNDGNTEAVSMWVCRALEERRMQSGQ 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
licNP_477162.1 PKc_MKK3_6 44..326 CDD:173729 117/289 (40%)
map2k5XP_017947570.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D688282at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.