DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lic and map2k6

DIOPT Version :9

Sequence 1:NP_477162.1 Gene:lic / 32257 FlyBaseID:FBgn0261524 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001005653.1 Gene:map2k6 / 448132 XenbaseID:XB-GENE-944183 Length:335 Species:Xenopus tropicalis


Alignment Length:304 Identity:189/304 - (62%)
Similarity:242/304 - (79%) Gaps:0/304 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PPRNLDSRATIQIGDRTFDIDADSLEKICDLGRGAYGIVDKMRHKQTDTVLAVKRIPMTVNIREQ 86
            |||:|||:|.|.||::.|::.||.||.|.:|||||||:|:||||..::.::|||||..|||.:||
 Frog    30 PPRDLDSKACILIGEKNFEVKADDLEPIEELGRGAYGVVEKMRHVPSEQIMAVKRIRATVNSQEQ 94

  Fly    87 HRLVMDLDISMRSSDCPYTVHFYGAMYREGDVWICMEVMSTSLDKFYPKVFLHDLRMEESVLGKI 151
            .||:||||||||:.||.:||.||||::||||||||||:|.|||||||..|....|.:.|.:||||
 Frog    95 KRLLMDLDISMRTVDCHFTVTFYGALFREGDVWICMELMDTSLDKFYKNVIDKGLTIPEDILGKI 159

  Fly   152 AMSVVSALHYLHAQLKVIHRDVKPSNILINRAGQVKICDFGISGYLVDSIAKTIDAGCKPYMAPE 216
            |:|:|.||.:||::|.||||||||||:|||:.||||:||||||||||||:|||:|||||||||||
 Frog   160 AVSIVRALEHLHSKLSVIHRDVKPSNVLINKEGQVKMCDFGISGYLVDSVAKTMDAGCKPYMAPE 224

  Fly   217 RIDPQGNPAQYDIRSDVWSLGIGMIEMATGRYPYDNWRTPFEQLRQVVEDSPPRLPEGTFSPEFE 281
            ||:|:.|...|.::||:|||||.:||:|..|:|||:|.|||:||:||||:..|:||...||.||.
 Frog   225 RINPELNQKGYSVKSDIWSLGITLIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFV 289

  Fly   282 DFIAVCLQKEYMARPNYEQLLKHSFIVEHLQRNTDISEFVARIL 325
            ||.:.||:|....||.|.:|::|.|.|.|..:|||::.||.|||
 Frog   290 DFTSKCLKKNSKERPTYPELMQHHFFVLHESKNTDVASFVKRIL 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
licNP_477162.1 PKc_MKK3_6 44..326 CDD:173729 177/282 (63%)
map2k6NP_001005653.1 PKc_MKK3_6 52..334 CDD:173729 177/282 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 351 1.000 Domainoid score I1016
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 402 1.000 Inparanoid score I1873
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D470057at33208
OrthoFinder 1 1.000 - - FOG0001217
OrthoInspector 1 1.000 - - oto103255
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2221
SonicParanoid 1 1.000 - - X2955
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.090

Return to query results.
Submit another query.