DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lic and Mekk1

DIOPT Version :9

Sequence 1:NP_477162.1 Gene:lic / 32257 FlyBaseID:FBgn0261524 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_732373.1 Gene:Mekk1 / 42253 FlyBaseID:FBgn0024329 Length:1571 Species:Drosophila melanogaster


Alignment Length:282 Identity:70/282 - (24%)
Similarity:129/282 - (45%) Gaps:55/282 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 LGRGAYGIVDKMRHKQTDTVLAVKRIPM-------TVNIREQHRLVMDLDISMRSSDCPYTVHFY 109
            :|:|.:|.|....:..|..::|:|.|.:       ..|:.|:.:::..:...       ..|.:|
  Fly  1288 IGQGRFGKVYTAVNNNTGELMAMKEIAIQPGETRALKNVAEELKILEGIKHK-------NLVRYY 1345

  Fly   110 GAMYREGDVWICMEVMSTSLDKFYPKVFLHDL-----RMEESVLGKIAMSVVSALHYLHAQLKVI 169
            |......::.|.||:.|...        |..|     .:.|::..:....::|.:..||.. .::
  Fly  1346 GIEVHREELLIFMELCSEGT--------LESLVELTGNLPEALTRRFTAQLLSGVSELHKH-GIV 1401

  Fly   170 HRDVKPSNI-LINRAGQVKICDFG--------------ISGYLVDSIAKTIDAGCKPYMAPERID 219
            |||:|.:|| |::.:..:|:.|||              :.||:          |.:.||||| :.
  Fly  1402 HRDIKTANIFLVDGSNSLKLGDFGSAVKIQAHTTVPGELQGYV----------GTQAYMAPE-VF 1455

  Fly   220 PQGNPAQYDIRSDVWSLGIGMIEMATGRYPYDNWRTPFEQLRQVVEDSPPRLPEGTFSPEFEDFI 284
            .:.|...:...:|:||:|..::|||:|:.|:..:.:.|:.:.:|.....|:.|| :.|.|..|||
  Fly  1456 TKTNSDGHGRAADIWSVGCVVVEMASGKRPWAQFDSNFQIMFKVGMGEKPQAPE-SLSQEGHDFI 1519

  Fly   285 AVCLQKEYMARPNYEQLLKHSF 306
            ..|||.:...|....:||:|:|
  Fly  1520 DHCLQHDPKRRLTAVELLEHNF 1541

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
licNP_477162.1 PKc_MKK3_6 44..326 CDD:173729 70/282 (25%)
Mekk1NP_732373.1 STKc_MEKK4 1281..1542 CDD:270796 70/282 (25%)
S_TKc 1282..1541 CDD:214567 69/280 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447167
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.