DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lic and MAP3K4

DIOPT Version :9

Sequence 1:NP_477162.1 Gene:lic / 32257 FlyBaseID:FBgn0261524 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_005913.3 Gene:MAP3K4 / 4216 HGNCID:6856 Length:1608 Species:Homo sapiens


Alignment Length:300 Identity:84/300 - (28%)
Similarity:143/300 - (47%) Gaps:38/300 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PRNLDSRATIQIGDRTFDIDADSLEKICDLGRGAYGIVDKMRHKQTDTVLAVKRIPMTVNIREQH 87
            |::.|:  .:.:|.|..........||   |.|.||.|.......|..::|:|.|....|   .|
Human  1325 PKSYDN--VMHVGLRKVTFKWQRGNKI---GEGQYGKVYTCISVDTGELMAMKEIRFQPN---DH 1381

  Fly    88 RLVMDLDISMRSSD---CPYTVHFYGAMYREGDVWICMEVMST-SLDKFYPKVFLHDLRMEESVL 148
            :.:.:....::..:   .|..|.::|......:::|.||.... :|::      :..|.::|.|:
Human  1382 KTIKETADELKIFEGIKHPNLVRYFGVELHREEMYIFMEYCDEGTLEE------VSRLGLQEHVI 1440

  Fly   149 GKIAMSVVSALHYLHAQLKVIHRDVKPSNILINRAGQVKICDFGISGYLVDSIAKTIDA------ 207
            ...:..:..|::.|| :..::|||:|.:||.:..:|.:|:.|||.|..|.:: |:|:..      
Human  1441 RLYSKQITIAINVLH-EHGIVHRDIKGANIFLTSSGLIKLGDFGCSVKLKNN-AQTMPGEVNSTL 1503

  Fly   208 GCKPYMAPERI-----DPQGNPAQYDIRSDVWSLGIGMIEMATGRYPYDNWRTPFEQLRQVVEDS 267
            |...|||||.|     :..|..|      |:||||..:|||.||:.|:..:...|:.:.:|....
Human  1504 GTAAYMAPEVITRAKGEGHGRAA------DIWSLGCVVIEMVTGKRPWHEYEHNFQIMYKVGMGH 1562

  Fly   268 PPRLPEGTFSPEFEDFIAVCLQKEYMARPNYEQLLKHSFI 307
            .|.:|| ..|||.:||::.||:.:...|....|||.|||:
Human  1563 KPPIPE-RLSPEGKDFLSHCLESDPKMRWTASQLLDHSFV 1601

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
licNP_477162.1 PKc_MKK3_6 44..326 CDD:173729 80/278 (29%)
MAP3K4NP_005913.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..136
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 429..478
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1157..1190
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1202..1231
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1244..1274
STKc_MEKK4 1342..1601 CDD:270796 79/279 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145985
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.