DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lic and MAP3K3

DIOPT Version :9

Sequence 1:NP_477162.1 Gene:lic / 32257 FlyBaseID:FBgn0261524 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_976226.1 Gene:MAP3K3 / 4215 HGNCID:6855 Length:657 Species:Homo sapiens


Alignment Length:344 Identity:91/344 - (26%)
Similarity:148/344 - (43%) Gaps:61/344 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KRHRLTPFTIAK-------------------EPEAAIVPPRNLDSRATIQIGDRTFDIDADSLE- 47
            :||:...||:..                   :|...:   |:.||...:.:.:|.....:.|.. 
Human   330 RRHQGNLFTLVPSSRSLSTNGENMGLAVQYLDPRGRL---RSADSENALSVQERNVPTKSPSAPI 391

  Fly    48 -----KICDLGRGAYGIVDKMRHKQTDTVLAVKRIPMTVNIREQHRLVMDLDIS---MRSSDCPY 104
                 |:  ||:||:|.|.......|...||.|::....:..|..:.|..|:..   :::.....
Human   392 NWRRGKL--LGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKNLQHER 454

  Fly   105 TVHFYGAM--YREGDVWICMEVMSTSLDKFYPKVFLHDLRMEESVLGKIAMSVVSALHYLHAQLK 167
            .|.:||.:  ..|..:.|.||.|.....|...|.:   ..:.|||..|....::..:.|||:.: 
Human   455 IVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAY---GALTESVTRKYTRQILEGMSYLHSNM- 515

  Fly   168 VIHRDVKPSNILINRAGQVKICDFG---------ISGYLVDSIAKTIDAGCKPY-MAPERIDPQG 222
            ::|||:|.:|||.:.||.||:.|||         :||..:.|:..|      || |:||.|..:|
Human   516 IVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGMRSVTGT------PYWMSPEVISGEG 574

  Fly   223 NPAQYDIRSDVWSLGIGMIEMATGRYPYDNWRTPFEQLRQVVEDSPPRLPEGTFSPEFEDFIAVC 287
                |..::||||||..::||.|.:.|:..:.......:...:.:.|:|| ...|....||:. .
Human   575 ----YGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPQLP-SHISEHGRDFLR-R 633

  Fly   288 LQKEYMARPNYEQLLKHSF 306
            :..|...||:.|:||.|.|
Human   634 IFVEARQRPSAEELLTHHF 652

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
licNP_477162.1 PKc_MKK3_6 44..326 CDD:173729 82/284 (29%)
MAP3K3NP_976226.1 PB1_Mekk2_3 76..154 CDD:99726
STKc_MEKK3_like 392..652 CDD:270795 80/277 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145986
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.